Compare commits

..
4 Commits
Author SHA1 Message Date
xtaci 8929bb029d upd pgo 2024-01-06 16:07:26 +08:00
xtaci 13f48e04df add vendor 2024-01-05 22:37:46 +08:00
xtaci fa0d5e0765 upd deps to v5.6.7 2024-01-05 22:37:22 +08:00
fuli 86443d924d upgrade deps to v5.6.6 2024-01-05 15:31:45 +08:00
428 changed files with 36633 additions and 1001 deletions
Binary file not shown.
+6 -6
View File
@@ -4,24 +4,24 @@ require (
github.com/golang/snappy v0.0.4
github.com/pkg/errors v0.9.1
github.com/urfave/cli v1.22.14
github.com/xtaci/kcp-go/v5 v5.6.5
github.com/xtaci/kcp-go/v5 v5.6.7
github.com/xtaci/smux v1.5.24
github.com/xtaci/tcpraw v1.2.25
golang.org/x/crypto v0.14.0
golang.org/x/crypto v0.17.0
)
require (
github.com/coreos/go-iptables v0.7.0 // indirect
github.com/cpuguy83/go-md2man/v2 v2.0.2 // indirect
github.com/google/gopacket v1.1.19 // indirect
github.com/klauspost/cpuid/v2 v2.2.5 // indirect
github.com/klauspost/reedsolomon v1.11.8 // indirect
github.com/klauspost/cpuid/v2 v2.2.6 // indirect
github.com/klauspost/reedsolomon v1.12.0 // indirect
github.com/russross/blackfriday/v2 v2.1.0 // indirect
github.com/templexxx/cpu v0.1.0 // indirect
github.com/templexxx/xorsimd v0.4.2 // indirect
github.com/tjfoc/gmsm v1.4.1 // indirect
golang.org/x/net v0.17.0 // indirect
golang.org/x/sys v0.13.0 // indirect
golang.org/x/net v0.19.0 // indirect
golang.org/x/sys v0.16.0 // indirect
)
go 1.21
+14 -14
View File
@@ -33,10 +33,10 @@ github.com/google/go-cmp v0.3.1/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMyw
github.com/google/go-cmp v0.4.0/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE=
github.com/google/gopacket v1.1.19 h1:ves8RnFZPGiFnTS0uPQStjwru6uO6h+nlr9j6fL7kF8=
github.com/google/gopacket v1.1.19/go.mod h1:iJ8V8n6KS+z2U1A8pUwu8bW5SyEMkXJB8Yo/Vo+TKTo=
github.com/klauspost/cpuid/v2 v2.2.5 h1:0E5MSMDEoAulmXNFquVs//DdoomxaoTY1kUhbc/qbZg=
github.com/klauspost/cpuid/v2 v2.2.5/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws=
github.com/klauspost/reedsolomon v1.11.8 h1:s8RpUW5TK4hjr+djiOpbZJB4ksx+TdYbRH7vHQpwPOY=
github.com/klauspost/reedsolomon v1.11.8/go.mod h1:4bXRN+cVzMdml6ti7qLouuYi32KHJ5MGv0Qd8a47h6A=
github.com/klauspost/cpuid/v2 v2.2.6 h1:ndNyv040zDGIDh8thGkXYjnFtiN02M1PVVF+JE/48xc=
github.com/klauspost/cpuid/v2 v2.2.6/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws=
github.com/klauspost/reedsolomon v1.12.0 h1:I5FEp3xSwVCcEh3F5A7dofEfhXdF/bWhQWPH+XwBFno=
github.com/klauspost/reedsolomon v1.12.0/go.mod h1:EPLZJeh4l27pUGC3aXOjheaoh1I9yut7xTURiW3LQ9Y=
github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4=
github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0=
github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
@@ -59,10 +59,10 @@ github.com/tjfoc/gmsm v1.4.1 h1:aMe1GlZb+0bLjn+cKTPEvvn9oUEBlJitaZiiBwsbgho=
github.com/tjfoc/gmsm v1.4.1/go.mod h1:j4INPkHWMrhJb38G+J6W4Tw0AbuN8Thu3PbdVYhVcTE=
github.com/urfave/cli v1.22.14 h1:ebbhrRiGK2i4naQJr+1Xj92HXZCrK7MsyTS/ob3HnAk=
github.com/urfave/cli v1.22.14/go.mod h1:X0eDS6pD6Exaclxm99NJ3FiCDRED7vIHpx2mDOHLvkA=
github.com/xtaci/kcp-go/v5 v5.6.3 h1:yd59SKXdJ0PBxeMBy3apalxFCEmBLGgQmL6nP46tU0g=
github.com/xtaci/kcp-go/v5 v5.6.3/go.mod h1:uIuw2KEg3FcmEdS4PeXHaGty9Ui7NYb1WKIrSDwpMg4=
github.com/xtaci/kcp-go/v5 v5.6.5 h1:oxGZNobj3OddrLzwdJYnR/waNgwrL98u02u0DWNHE3k=
github.com/xtaci/kcp-go/v5 v5.6.5/go.mod h1:Qy3Zf2tWTdFdEs0E8JvhrX+39r5UDZoYac8anvud7/Q=
github.com/xtaci/kcp-go/v5 v5.6.6 h1:SxSjZoaaLzQKxbIfzE1FYLMKtR2veox5mvKO7AliZ5I=
github.com/xtaci/kcp-go/v5 v5.6.6/go.mod h1:oE9j2NVqAkuKO5o8ByKGch3vgVX3BNf8zqP8JiGq0bM=
github.com/xtaci/kcp-go/v5 v5.6.7 h1:7+rnxNFIsjEwTXQk4cSZpXM4pO0hqtpwE1UFFoJBffA=
github.com/xtaci/kcp-go/v5 v5.6.7/go.mod h1:oE9j2NVqAkuKO5o8ByKGch3vgVX3BNf8zqP8JiGq0bM=
github.com/xtaci/lossyconn v0.0.0-20190602105132-8df528c0c9ae h1:J0GxkO96kL4WF+AIT3M4mfUVinOCPgf2uUWYFUzN0sM=
github.com/xtaci/lossyconn v0.0.0-20190602105132-8df528c0c9ae/go.mod h1:gXtu8J62kEgmN++bm9BVICuT/e8yiLI2KFobd/TRFsE=
github.com/xtaci/smux v1.5.24 h1:77emW9dtnOxxOQ5ltR+8BbsX1kzcOxQ5gB+aaV9hXOY=
@@ -73,8 +73,8 @@ golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACk
golang.org/x/crypto v0.0.0-20191011191535-87dc89f01550/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI=
golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto=
golang.org/x/crypto v0.0.0-20201012173705-84dcc777aaee/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto=
golang.org/x/crypto v0.14.0 h1:wBqGXzWJW6m1XrIKlAH0Hs1JJ7+9KBwnIO8v66Q9cHc=
golang.org/x/crypto v0.14.0/go.mod h1:MVFd36DqK4CsrnJYDkBA3VC4m2GkXAM0PvzMCn4JQf4=
golang.org/x/crypto v0.17.0 h1:r8bRNjWL3GshPW3gkd+RpvzWrZAwPS49OmTGZ/uhM4k=
golang.org/x/crypto v0.17.0/go.mod h1:gCAAfMLgwOJRpTjQ2zCCt2OcSfYMTeZVSRtQlPC7Nq4=
golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA=
golang.org/x/lint v0.0.0-20181026193005-c67002cb31c3/go.mod h1:UVdnD1Gm6xHRNCYTkRU2/jEulfH38KcIWyp/GAMgvoE=
golang.org/x/lint v0.0.0-20190227174305-5b3e6a55c961/go.mod h1:wehouNa3lNwaWXcvxsM5YxQ5yQlVC4a0KAMCusXpPoU=
@@ -88,8 +88,8 @@ golang.org/x/net v0.0.0-20190311183353-d8887717615a/go.mod h1:t9HGtf8HONx5eT2rtn
golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg=
golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
golang.org/x/net v0.0.0-20201010224723-4f7140c49acb/go.mod h1:sp8m0HH+o8qH0wwXwYZr8TS3Oi6o0r6Gce1SSxlDquU=
golang.org/x/net v0.17.0 h1:pVaXccu2ozPjCXewfr1S7xza/zcXTity9cCdXQYSjIM=
golang.org/x/net v0.17.0/go.mod h1:NxSsAGuq816PNPmqtQdLE42eU2Fs7NoRIZrHJAlaCOE=
golang.org/x/net v0.19.0 h1:zTwKpTd2XuCqf8huc7Fo2iSy+4RHPd10s4KzeTnVr1c=
golang.org/x/net v0.19.0/go.mod h1:CfAk/cbD4CthTvqiEl8NpboMuiuOYsAr/7NOjZJtv1U=
golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U=
golang.org/x/sync v0.0.0-20180314180146-1d60e4601c6f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
@@ -99,8 +99,8 @@ golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5h
golang.org/x/sys v0.0.0-20190412213103-97732733099d/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.0.0-20200930185726-fdedc70b468f/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.13.0 h1:Af8nKPmuFypiUBjVoU9V20FiaFXOcuZI21p0ycVYYGE=
golang.org/x/sys v0.13.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.16.0 h1:xWw16ngr6ZMtmxDyKyIgsE93KNKz5HKmMa3b8ALHidU=
golang.org/x/sys v0.16.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
+9 -5
View File
@@ -9,10 +9,7 @@ You can access the CPU information by accessing the shared CPU variable of the c
Package home: https://github.com/klauspost/cpuid
[![PkgGoDev](https://pkg.go.dev/badge/github.com/klauspost/cpuid)](https://pkg.go.dev/github.com/klauspost/cpuid/v2)
[![Build Status][3]][4]
[3]: https://travis-ci.org/klauspost/cpuid.svg?branch=master
[4]: https://travis-ci.org/klauspost/cpuid
[![Go](https://github.com/klauspost/cpuid/actions/workflows/go.yml/badge.svg)](https://github.com/klauspost/cpuid/actions/workflows/go.yml)
## installing
@@ -285,7 +282,12 @@ Exit Code 1
| AMXINT8 | Tile computational operations on 8-bit integers |
| AMXFP16 | Tile computational operations on FP16 numbers |
| AMXTILE | Tile architecture |
| APX_F | Intel APX |
| AVX | AVX functions |
| AVX10 | If set the Intel AVX10 Converged Vector ISA is supported |
| AVX10_128 | If set indicates that AVX10 128-bit vector support is present |
| AVX10_256 | If set indicates that AVX10 256-bit vector support is present |
| AVX10_512 | If set indicates that AVX10 512-bit vector support is present |
| AVX2 | AVX2 functions |
| AVX512BF16 | AVX-512 BFLOAT16 Instructions |
| AVX512BITALG | AVX-512 Bit Algorithms |
@@ -365,6 +367,8 @@ Exit Code 1
| IDPRED_CTRL | IPRED_DIS |
| INT_WBINVD | WBINVD/WBNOINVD are interruptible. |
| INVLPGB | NVLPGB and TLBSYNC instruction supported |
| KEYLOCKER | Key locker |
| KEYLOCKERW | Key locker wide |
| LAHF | LAHF/SAHF in long mode |
| LAM | If set, CPU supports Linear Address Masking |
| LBRVIRT | LBR virtualization |
@@ -380,7 +384,7 @@ Exit Code 1
| MOVDIRI | Move Doubleword as Direct Store |
| MOVSB_ZL | Fast Zero-Length MOVSB |
| MPX | Intel MPX (Memory Protection Extensions) |
| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD |
| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD |
| MSRIRC | Instruction Retired Counter MSR available |
| MSRLIST | Read/Write List of Model Specific Registers |
| MSR_PAGEFLUSH | Page Flush MSR available |
+49 -3
View File
@@ -76,7 +76,12 @@ const (
AMXFP16 // Tile computational operations on FP16 numbers
AMXINT8 // Tile computational operations on 8-bit integers
AMXTILE // Tile architecture
APX_F // Intel APX
AVX // AVX functions
AVX10 // If set the Intel AVX10 Converged Vector ISA is supported
AVX10_128 // If set indicates that AVX10 128-bit vector support is present
AVX10_256 // If set indicates that AVX10 256-bit vector support is present
AVX10_512 // If set indicates that AVX10 512-bit vector support is present
AVX2 // AVX2 functions
AVX512BF16 // AVX-512 BFLOAT16 Instructions
AVX512BITALG // AVX-512 Bit Algorithms
@@ -156,6 +161,8 @@ const (
IDPRED_CTRL // IPRED_DIS
INT_WBINVD // WBINVD/WBNOINVD are interruptible.
INVLPGB // NVLPGB and TLBSYNC instruction supported
KEYLOCKER // Key locker
KEYLOCKERW // Key locker wide
LAHF // LAHF/SAHF in long mode
LAM // If set, CPU supports Linear Address Masking
LBRVIRT // LBR virtualization
@@ -302,9 +309,10 @@ type CPUInfo struct {
L2 int // L2 Cache (per core or shared). Will be -1 if undetected
L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected
}
SGX SGXSupport
maxFunc uint32
maxExFunc uint32
SGX SGXSupport
AVX10Level uint8
maxFunc uint32
maxExFunc uint32
}
var cpuid func(op uint32) (eax, ebx, ecx, edx uint32)
@@ -1165,6 +1173,7 @@ func support() flagSet {
fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ)
fs.setIf(ecx&(1<<13) != 0, TME)
fs.setIf(ecx&(1<<25) != 0, CLDEMOTE)
fs.setIf(ecx&(1<<23) != 0, KEYLOCKER)
fs.setIf(ecx&(1<<27) != 0, MOVDIRI)
fs.setIf(ecx&(1<<28) != 0, MOVDIR64B)
fs.setIf(ecx&(1<<29) != 0, ENQCMD)
@@ -1202,6 +1211,8 @@ func support() flagSet {
fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
fs.setIf(edx1&(1<<19) != 0, AVX10)
fs.setIf(edx1&(1<<21) != 0, APX_F)
// Only detect AVX-512 features if XGETBV is supported
if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) {
@@ -1252,6 +1263,19 @@ func support() flagSet {
fs.setIf(edx&(1<<4) != 0, BHI_CTRL)
fs.setIf(edx&(1<<5) != 0, MCDT_NO)
// Add keylocker features.
if fs.inSet(KEYLOCKER) && mfi >= 0x19 {
_, ebx, _, _ := cpuidex(0x19, 0)
fs.setIf(ebx&5 == 5, KEYLOCKERW) // Bit 0 and 2 (1+4)
}
// Add AVX10 features.
if fs.inSet(AVX10) && mfi >= 0x24 {
_, ebx, _, _ := cpuidex(0x24, 0)
fs.setIf(ebx&(1<<16) != 0, AVX10_128)
fs.setIf(ebx&(1<<17) != 0, AVX10_256)
fs.setIf(ebx&(1<<18) != 0, AVX10_512)
}
}
// Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1)
@@ -1394,6 +1418,20 @@ func support() flagSet {
fs.setIf((a>>24)&1 == 1, VMSA_REGPROT)
}
if mfi >= 0x20 {
// Microsoft has decided to purposefully hide the information
// of the guest TEE when VMs are being created using Hyper-V.
//
// This leads us to check for the Hyper-V cpuid features
// (0x4000000C), and then for the `ebx` value set.
//
// For Intel TDX, `ebx` is set as `0xbe3`, being 3 the part
// we're mostly interested about,according to:
// https://github.com/torvalds/linux/blob/d2f51b3516dade79269ff45eae2a7668ae711b25/arch/x86/include/asm/hyperv-tlfs.h#L169-L174
_, ebx, _, _ := cpuid(0x4000000C)
fs.setIf(ebx == 0xbe3, TDX_GUEST)
}
if mfi >= 0x21 {
// Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21).
_, ebx, ecx, edx := cpuid(0x21)
@@ -1404,6 +1442,14 @@ func support() flagSet {
return fs
}
func (c *CPUInfo) supportAVX10() uint8 {
if c.maxFunc >= 0x24 && c.featureSet.inSet(AVX10) {
_, ebx, _, _ := cpuidex(0x24, 0)
return uint8(ebx)
}
return 0
}
func valAsString(values ...uint32) []byte {
r := make([]byte, 4*len(values))
for i, v := range values {
+1
View File
@@ -31,6 +31,7 @@ func addInfo(c *CPUInfo, safe bool) {
c.LogicalCores = logicalCores()
c.PhysicalCores = physicalCores()
c.VendorID, c.VendorString = vendorID()
c.AVX10Level = c.supportAVX10()
c.cacheSize()
c.frequencies()
}
+207 -200
View File
@@ -16,210 +16,217 @@ func _() {
_ = x[AMXFP16-6]
_ = x[AMXINT8-7]
_ = x[AMXTILE-8]
_ = x[AVX-9]
_ = x[AVX2-10]
_ = x[AVX512BF16-11]
_ = x[AVX512BITALG-12]
_ = x[AVX512BW-13]
_ = x[AVX512CD-14]
_ = x[AVX512DQ-15]
_ = x[AVX512ER-16]
_ = x[AVX512F-17]
_ = x[AVX512FP16-18]
_ = x[AVX512IFMA-19]
_ = x[AVX512PF-20]
_ = x[AVX512VBMI-21]
_ = x[AVX512VBMI2-22]
_ = x[AVX512VL-23]
_ = x[AVX512VNNI-24]
_ = x[AVX512VP2INTERSECT-25]
_ = x[AVX512VPOPCNTDQ-26]
_ = x[AVXIFMA-27]
_ = x[AVXNECONVERT-28]
_ = x[AVXSLOW-29]
_ = x[AVXVNNI-30]
_ = x[AVXVNNIINT8-31]
_ = x[BHI_CTRL-32]
_ = x[BMI1-33]
_ = x[BMI2-34]
_ = x[CETIBT-35]
_ = x[CETSS-36]
_ = x[CLDEMOTE-37]
_ = x[CLMUL-38]
_ = x[CLZERO-39]
_ = x[CMOV-40]
_ = x[CMPCCXADD-41]
_ = x[CMPSB_SCADBS_SHORT-42]
_ = x[CMPXCHG8-43]
_ = x[CPBOOST-44]
_ = x[CPPC-45]
_ = x[CX16-46]
_ = x[EFER_LMSLE_UNS-47]
_ = x[ENQCMD-48]
_ = x[ERMS-49]
_ = x[F16C-50]
_ = x[FLUSH_L1D-51]
_ = x[FMA3-52]
_ = x[FMA4-53]
_ = x[FP128-54]
_ = x[FP256-55]
_ = x[FSRM-56]
_ = x[FXSR-57]
_ = x[FXSROPT-58]
_ = x[GFNI-59]
_ = x[HLE-60]
_ = x[HRESET-61]
_ = x[HTT-62]
_ = x[HWA-63]
_ = x[HYBRID_CPU-64]
_ = x[HYPERVISOR-65]
_ = x[IA32_ARCH_CAP-66]
_ = x[IA32_CORE_CAP-67]
_ = x[IBPB-68]
_ = x[IBRS-69]
_ = x[IBRS_PREFERRED-70]
_ = x[IBRS_PROVIDES_SMP-71]
_ = x[IBS-72]
_ = x[IBSBRNTRGT-73]
_ = x[IBSFETCHSAM-74]
_ = x[IBSFFV-75]
_ = x[IBSOPCNT-76]
_ = x[IBSOPCNTEXT-77]
_ = x[IBSOPSAM-78]
_ = x[IBSRDWROPCNT-79]
_ = x[IBSRIPINVALIDCHK-80]
_ = x[IBS_FETCH_CTLX-81]
_ = x[IBS_OPDATA4-82]
_ = x[IBS_OPFUSE-83]
_ = x[IBS_PREVENTHOST-84]
_ = x[IBS_ZEN4-85]
_ = x[IDPRED_CTRL-86]
_ = x[INT_WBINVD-87]
_ = x[INVLPGB-88]
_ = x[LAHF-89]
_ = x[LAM-90]
_ = x[LBRVIRT-91]
_ = x[LZCNT-92]
_ = x[MCAOVERFLOW-93]
_ = x[MCDT_NO-94]
_ = x[MCOMMIT-95]
_ = x[MD_CLEAR-96]
_ = x[MMX-97]
_ = x[MMXEXT-98]
_ = x[MOVBE-99]
_ = x[MOVDIR64B-100]
_ = x[MOVDIRI-101]
_ = x[MOVSB_ZL-102]
_ = x[MOVU-103]
_ = x[MPX-104]
_ = x[MSRIRC-105]
_ = x[MSRLIST-106]
_ = x[MSR_PAGEFLUSH-107]
_ = x[NRIPS-108]
_ = x[NX-109]
_ = x[OSXSAVE-110]
_ = x[PCONFIG-111]
_ = x[POPCNT-112]
_ = x[PPIN-113]
_ = x[PREFETCHI-114]
_ = x[PSFD-115]
_ = x[RDPRU-116]
_ = x[RDRAND-117]
_ = x[RDSEED-118]
_ = x[RDTSCP-119]
_ = x[RRSBA_CTRL-120]
_ = x[RTM-121]
_ = x[RTM_ALWAYS_ABORT-122]
_ = x[SERIALIZE-123]
_ = x[SEV-124]
_ = x[SEV_64BIT-125]
_ = x[SEV_ALTERNATIVE-126]
_ = x[SEV_DEBUGSWAP-127]
_ = x[SEV_ES-128]
_ = x[SEV_RESTRICTED-129]
_ = x[SEV_SNP-130]
_ = x[SGX-131]
_ = x[SGXLC-132]
_ = x[SHA-133]
_ = x[SME-134]
_ = x[SME_COHERENT-135]
_ = x[SPEC_CTRL_SSBD-136]
_ = x[SRBDS_CTRL-137]
_ = x[SSE-138]
_ = x[SSE2-139]
_ = x[SSE3-140]
_ = x[SSE4-141]
_ = x[SSE42-142]
_ = x[SSE4A-143]
_ = x[SSSE3-144]
_ = x[STIBP-145]
_ = x[STIBP_ALWAYSON-146]
_ = x[STOSB_SHORT-147]
_ = x[SUCCOR-148]
_ = x[SVM-149]
_ = x[SVMDA-150]
_ = x[SVMFBASID-151]
_ = x[SVML-152]
_ = x[SVMNP-153]
_ = x[SVMPF-154]
_ = x[SVMPFT-155]
_ = x[SYSCALL-156]
_ = x[SYSEE-157]
_ = x[TBM-158]
_ = x[TDX_GUEST-159]
_ = x[TLB_FLUSH_NESTED-160]
_ = x[TME-161]
_ = x[TOPEXT-162]
_ = x[TSCRATEMSR-163]
_ = x[TSXLDTRK-164]
_ = x[VAES-165]
_ = x[VMCBCLEAN-166]
_ = x[VMPL-167]
_ = x[VMSA_REGPROT-168]
_ = x[VMX-169]
_ = x[VPCLMULQDQ-170]
_ = x[VTE-171]
_ = x[WAITPKG-172]
_ = x[WBNOINVD-173]
_ = x[WRMSRNS-174]
_ = x[X87-175]
_ = x[XGETBV1-176]
_ = x[XOP-177]
_ = x[XSAVE-178]
_ = x[XSAVEC-179]
_ = x[XSAVEOPT-180]
_ = x[XSAVES-181]
_ = x[AESARM-182]
_ = x[ARMCPUID-183]
_ = x[ASIMD-184]
_ = x[ASIMDDP-185]
_ = x[ASIMDHP-186]
_ = x[ASIMDRDM-187]
_ = x[ATOMICS-188]
_ = x[CRC32-189]
_ = x[DCPOP-190]
_ = x[EVTSTRM-191]
_ = x[FCMA-192]
_ = x[FP-193]
_ = x[FPHP-194]
_ = x[GPA-195]
_ = x[JSCVT-196]
_ = x[LRCPC-197]
_ = x[PMULL-198]
_ = x[SHA1-199]
_ = x[SHA2-200]
_ = x[SHA3-201]
_ = x[SHA512-202]
_ = x[SM3-203]
_ = x[SM4-204]
_ = x[SVE-205]
_ = x[lastID-206]
_ = x[APX_F-9]
_ = x[AVX-10]
_ = x[AVX10-11]
_ = x[AVX10_128-12]
_ = x[AVX10_256-13]
_ = x[AVX10_512-14]
_ = x[AVX2-15]
_ = x[AVX512BF16-16]
_ = x[AVX512BITALG-17]
_ = x[AVX512BW-18]
_ = x[AVX512CD-19]
_ = x[AVX512DQ-20]
_ = x[AVX512ER-21]
_ = x[AVX512F-22]
_ = x[AVX512FP16-23]
_ = x[AVX512IFMA-24]
_ = x[AVX512PF-25]
_ = x[AVX512VBMI-26]
_ = x[AVX512VBMI2-27]
_ = x[AVX512VL-28]
_ = x[AVX512VNNI-29]
_ = x[AVX512VP2INTERSECT-30]
_ = x[AVX512VPOPCNTDQ-31]
_ = x[AVXIFMA-32]
_ = x[AVXNECONVERT-33]
_ = x[AVXSLOW-34]
_ = x[AVXVNNI-35]
_ = x[AVXVNNIINT8-36]
_ = x[BHI_CTRL-37]
_ = x[BMI1-38]
_ = x[BMI2-39]
_ = x[CETIBT-40]
_ = x[CETSS-41]
_ = x[CLDEMOTE-42]
_ = x[CLMUL-43]
_ = x[CLZERO-44]
_ = x[CMOV-45]
_ = x[CMPCCXADD-46]
_ = x[CMPSB_SCADBS_SHORT-47]
_ = x[CMPXCHG8-48]
_ = x[CPBOOST-49]
_ = x[CPPC-50]
_ = x[CX16-51]
_ = x[EFER_LMSLE_UNS-52]
_ = x[ENQCMD-53]
_ = x[ERMS-54]
_ = x[F16C-55]
_ = x[FLUSH_L1D-56]
_ = x[FMA3-57]
_ = x[FMA4-58]
_ = x[FP128-59]
_ = x[FP256-60]
_ = x[FSRM-61]
_ = x[FXSR-62]
_ = x[FXSROPT-63]
_ = x[GFNI-64]
_ = x[HLE-65]
_ = x[HRESET-66]
_ = x[HTT-67]
_ = x[HWA-68]
_ = x[HYBRID_CPU-69]
_ = x[HYPERVISOR-70]
_ = x[IA32_ARCH_CAP-71]
_ = x[IA32_CORE_CAP-72]
_ = x[IBPB-73]
_ = x[IBRS-74]
_ = x[IBRS_PREFERRED-75]
_ = x[IBRS_PROVIDES_SMP-76]
_ = x[IBS-77]
_ = x[IBSBRNTRGT-78]
_ = x[IBSFETCHSAM-79]
_ = x[IBSFFV-80]
_ = x[IBSOPCNT-81]
_ = x[IBSOPCNTEXT-82]
_ = x[IBSOPSAM-83]
_ = x[IBSRDWROPCNT-84]
_ = x[IBSRIPINVALIDCHK-85]
_ = x[IBS_FETCH_CTLX-86]
_ = x[IBS_OPDATA4-87]
_ = x[IBS_OPFUSE-88]
_ = x[IBS_PREVENTHOST-89]
_ = x[IBS_ZEN4-90]
_ = x[IDPRED_CTRL-91]
_ = x[INT_WBINVD-92]
_ = x[INVLPGB-93]
_ = x[KEYLOCKER-94]
_ = x[KEYLOCKERW-95]
_ = x[LAHF-96]
_ = x[LAM-97]
_ = x[LBRVIRT-98]
_ = x[LZCNT-99]
_ = x[MCAOVERFLOW-100]
_ = x[MCDT_NO-101]
_ = x[MCOMMIT-102]
_ = x[MD_CLEAR-103]
_ = x[MMX-104]
_ = x[MMXEXT-105]
_ = x[MOVBE-106]
_ = x[MOVDIR64B-107]
_ = x[MOVDIRI-108]
_ = x[MOVSB_ZL-109]
_ = x[MOVU-110]
_ = x[MPX-111]
_ = x[MSRIRC-112]
_ = x[MSRLIST-113]
_ = x[MSR_PAGEFLUSH-114]
_ = x[NRIPS-115]
_ = x[NX-116]
_ = x[OSXSAVE-117]
_ = x[PCONFIG-118]
_ = x[POPCNT-119]
_ = x[PPIN-120]
_ = x[PREFETCHI-121]
_ = x[PSFD-122]
_ = x[RDPRU-123]
_ = x[RDRAND-124]
_ = x[RDSEED-125]
_ = x[RDTSCP-126]
_ = x[RRSBA_CTRL-127]
_ = x[RTM-128]
_ = x[RTM_ALWAYS_ABORT-129]
_ = x[SERIALIZE-130]
_ = x[SEV-131]
_ = x[SEV_64BIT-132]
_ = x[SEV_ALTERNATIVE-133]
_ = x[SEV_DEBUGSWAP-134]
_ = x[SEV_ES-135]
_ = x[SEV_RESTRICTED-136]
_ = x[SEV_SNP-137]
_ = x[SGX-138]
_ = x[SGXLC-139]
_ = x[SHA-140]
_ = x[SME-141]
_ = x[SME_COHERENT-142]
_ = x[SPEC_CTRL_SSBD-143]
_ = x[SRBDS_CTRL-144]
_ = x[SSE-145]
_ = x[SSE2-146]
_ = x[SSE3-147]
_ = x[SSE4-148]
_ = x[SSE42-149]
_ = x[SSE4A-150]
_ = x[SSSE3-151]
_ = x[STIBP-152]
_ = x[STIBP_ALWAYSON-153]
_ = x[STOSB_SHORT-154]
_ = x[SUCCOR-155]
_ = x[SVM-156]
_ = x[SVMDA-157]
_ = x[SVMFBASID-158]
_ = x[SVML-159]
_ = x[SVMNP-160]
_ = x[SVMPF-161]
_ = x[SVMPFT-162]
_ = x[SYSCALL-163]
_ = x[SYSEE-164]
_ = x[TBM-165]
_ = x[TDX_GUEST-166]
_ = x[TLB_FLUSH_NESTED-167]
_ = x[TME-168]
_ = x[TOPEXT-169]
_ = x[TSCRATEMSR-170]
_ = x[TSXLDTRK-171]
_ = x[VAES-172]
_ = x[VMCBCLEAN-173]
_ = x[VMPL-174]
_ = x[VMSA_REGPROT-175]
_ = x[VMX-176]
_ = x[VPCLMULQDQ-177]
_ = x[VTE-178]
_ = x[WAITPKG-179]
_ = x[WBNOINVD-180]
_ = x[WRMSRNS-181]
_ = x[X87-182]
_ = x[XGETBV1-183]
_ = x[XOP-184]
_ = x[XSAVE-185]
_ = x[XSAVEC-186]
_ = x[XSAVEOPT-187]
_ = x[XSAVES-188]
_ = x[AESARM-189]
_ = x[ARMCPUID-190]
_ = x[ASIMD-191]
_ = x[ASIMDDP-192]
_ = x[ASIMDHP-193]
_ = x[ASIMDRDM-194]
_ = x[ATOMICS-195]
_ = x[CRC32-196]
_ = x[DCPOP-197]
_ = x[EVTSTRM-198]
_ = x[FCMA-199]
_ = x[FP-200]
_ = x[FPHP-201]
_ = x[GPA-202]
_ = x[JSCVT-203]
_ = x[LRCPC-204]
_ = x[PMULL-205]
_ = x[SHA1-206]
_ = x[SHA2-207]
_ = x[SHA3-208]
_ = x[SHA512-209]
_ = x[SM3-210]
_ = x[SM4-211]
_ = x[SVE-212]
_ = x[lastID-213]
_ = x[firstID-0]
}
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465}
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 319, 323, 327, 333, 338, 346, 351, 357, 361, 370, 388, 396, 403, 407, 411, 425, 431, 435, 439, 448, 452, 456, 461, 466, 470, 474, 481, 485, 488, 494, 497, 500, 510, 520, 533, 546, 550, 554, 568, 585, 588, 598, 609, 615, 623, 634, 642, 654, 670, 684, 695, 705, 720, 728, 739, 749, 756, 765, 775, 779, 782, 789, 794, 805, 812, 819, 827, 830, 836, 841, 850, 857, 865, 869, 872, 878, 885, 898, 903, 905, 912, 919, 925, 929, 938, 942, 947, 953, 959, 965, 975, 978, 994, 1003, 1006, 1015, 1030, 1043, 1049, 1063, 1070, 1073, 1078, 1081, 1084, 1096, 1110, 1120, 1123, 1127, 1131, 1135, 1140, 1145, 1150, 1155, 1169, 1180, 1186, 1189, 1194, 1203, 1207, 1212, 1217, 1223, 1230, 1235, 1238, 1247, 1263, 1266, 1272, 1282, 1290, 1294, 1303, 1307, 1319, 1322, 1332, 1335, 1342, 1350, 1357, 1360, 1367, 1370, 1375, 1381, 1389, 1395, 1401, 1409, 1414, 1421, 1428, 1436, 1443, 1448, 1453, 1460, 1464, 1466, 1470, 1473, 1478, 1483, 1488, 1492, 1496, 1500, 1506, 1509, 1512, 1515, 1521}
func (i FeatureID) String() string {
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
+15
View File
@@ -534,6 +534,21 @@ BenchmarkGaloisXor128K-160 862.02 7905.00 9.17x
BenchmarkGaloisXor1M-160 784.60 6296.65 8.03x
```
# Legal
> None of section below is legal advice. Seek your own legal counsel.
> As stated by the [LICENSE](LICENSE) the authors will not be held reliable for any use of this library.
> Users are encouraged to independently verify they comply with all legal requirements.
As can be seen in [recent news](https://www.datanami.com/2023/10/16/cloudera-hit-with-240-million-judgement-over-erasure-coding/)
there has been lawsuits related to possible patents of aspects of erasure coding functionality.
As a possible mitigation it is possible to use the tag `nopshufb` when compiling any code which includes this package.
This will remove all inclusion and use of `PSHUFB` and equivalent on other platforms.
This is done by adding `-tags=nopshufb` to `go build` and similar commands that produce binary output.
The removed code may not be infringing and even after `-tags=nopshufb` there may still be infringing code left.
# Links
* [Backblaze Open Sources Reed-Solomon Erasure Coding Source Code](https://www.backblaze.com/blog/reed-solomon/).
+13 -8
View File
@@ -62,21 +62,17 @@ var logTable = [fieldSize]byte{
/**
* Inverse of the logarithm table. Maps integer logarithms
* to members of the field. There is no entry for 255
* because the highest log is 254.
* to members of the field. Entry 255 is the same as entry 0 sue to mod 255.
*
* This table was generated by `go run gentables.go`
* Table has been truncated to 256 bytes, since no lookups are bigger.
*/
var expTable = []byte{0x1, 0x2, 0x4, 0x8, 0x10, 0x20, 0x40, 0x80, 0x1d, 0x3a, 0x74, 0xe8, 0xcd, 0x87, 0x13, 0x26, 0x4c, 0x98, 0x2d, 0x5a, 0xb4, 0x75, 0xea, 0xc9, 0x8f, 0x3, 0x6, 0xc, 0x18, 0x30, 0x60, 0xc0, 0x9d, 0x27, 0x4e, 0x9c, 0x25, 0x4a, 0x94, 0x35, 0x6a, 0xd4, 0xb5, 0x77, 0xee, 0xc1, 0x9f, 0x23, 0x46, 0x8c, 0x5, 0xa, 0x14, 0x28, 0x50, 0xa0, 0x5d, 0xba, 0x69, 0xd2, 0xb9, 0x6f, 0xde, 0xa1, 0x5f, 0xbe, 0x61, 0xc2, 0x99, 0x2f, 0x5e, 0xbc, 0x65, 0xca, 0x89, 0xf, 0x1e, 0x3c, 0x78, 0xf0, 0xfd, 0xe7, 0xd3, 0xbb, 0x6b, 0xd6, 0xb1, 0x7f, 0xfe, 0xe1, 0xdf, 0xa3, 0x5b, 0xb6, 0x71, 0xe2, 0xd9, 0xaf, 0x43, 0x86, 0x11, 0x22, 0x44, 0x88, 0xd, 0x1a, 0x34, 0x68, 0xd0, 0xbd, 0x67, 0xce, 0x81, 0x1f, 0x3e, 0x7c, 0xf8, 0xed, 0xc7, 0x93, 0x3b, 0x76, 0xec, 0xc5, 0x97, 0x33, 0x66, 0xcc, 0x85, 0x17, 0x2e, 0x5c, 0xb8, 0x6d, 0xda, 0xa9, 0x4f, 0x9e, 0x21, 0x42, 0x84, 0x15, 0x2a, 0x54, 0xa8, 0x4d, 0x9a, 0x29, 0x52, 0xa4, 0x55, 0xaa, 0x49, 0x92, 0x39, 0x72, 0xe4, 0xd5, 0xb7, 0x73, 0xe6, 0xd1, 0xbf, 0x63, 0xc6, 0x91, 0x3f, 0x7e, 0xfc, 0xe5, 0xd7, 0xb3, 0x7b, 0xf6, 0xf1, 0xff, 0xe3, 0xdb, 0xab, 0x4b, 0x96, 0x31, 0x62, 0xc4, 0x95, 0x37, 0x6e, 0xdc, 0xa5, 0x57, 0xae, 0x41, 0x82, 0x19, 0x32, 0x64, 0xc8, 0x8d, 0x7, 0xe, 0x1c, 0x38, 0x70, 0xe0, 0xdd, 0xa7, 0x53, 0xa6, 0x51, 0xa2, 0x59, 0xb2, 0x79, 0xf2, 0xf9, 0xef, 0xc3, 0x9b, 0x2b, 0x56, 0xac, 0x45, 0x8a, 0x9, 0x12, 0x24, 0x48, 0x90, 0x3d, 0x7a, 0xf4, 0xf5, 0xf7, 0xf3, 0xfb, 0xeb, 0xcb, 0x8b, 0xb, 0x16, 0x2c, 0x58, 0xb0, 0x7d, 0xfa, 0xe9, 0xcf, 0x83, 0x1b, 0x36, 0x6c, 0xd8, 0xad, 0x47, 0x8e, 0x1, 0x2, 0x4, 0x8, 0x10, 0x20, 0x40, 0x80, 0x1d, 0x3a, 0x74, 0xe8, 0xcd, 0x87, 0x13, 0x26, 0x4c, 0x98, 0x2d, 0x5a, 0xb4, 0x75, 0xea, 0xc9, 0x8f, 0x3, 0x6, 0xc, 0x18, 0x30, 0x60, 0xc0, 0x9d, 0x27, 0x4e, 0x9c, 0x25, 0x4a, 0x94, 0x35, 0x6a, 0xd4, 0xb5, 0x77, 0xee, 0xc1, 0x9f, 0x23, 0x46, 0x8c, 0x5, 0xa, 0x14, 0x28, 0x50, 0xa0, 0x5d, 0xba, 0x69, 0xd2, 0xb9, 0x6f, 0xde, 0xa1, 0x5f, 0xbe, 0x61, 0xc2, 0x99, 0x2f, 0x5e, 0xbc, 0x65, 0xca, 0x89, 0xf, 0x1e, 0x3c, 0x78, 0xf0, 0xfd, 0xe7, 0xd3, 0xbb, 0x6b, 0xd6, 0xb1, 0x7f, 0xfe, 0xe1, 0xdf, 0xa3, 0x5b, 0xb6, 0x71, 0xe2, 0xd9, 0xaf, 0x43, 0x86, 0x11, 0x22, 0x44, 0x88, 0xd, 0x1a, 0x34, 0x68, 0xd0, 0xbd, 0x67, 0xce, 0x81, 0x1f, 0x3e, 0x7c, 0xf8, 0xed, 0xc7, 0x93, 0x3b, 0x76, 0xec, 0xc5, 0x97, 0x33, 0x66, 0xcc, 0x85, 0x17, 0x2e, 0x5c, 0xb8, 0x6d, 0xda, 0xa9, 0x4f, 0x9e, 0x21, 0x42, 0x84, 0x15, 0x2a, 0x54, 0xa8, 0x4d, 0x9a, 0x29, 0x52, 0xa4, 0x55, 0xaa, 0x49, 0x92, 0x39, 0x72, 0xe4, 0xd5, 0xb7, 0x73, 0xe6, 0xd1, 0xbf, 0x63, 0xc6, 0x91, 0x3f, 0x7e, 0xfc, 0xe5, 0xd7, 0xb3, 0x7b, 0xf6, 0xf1, 0xff, 0xe3, 0xdb, 0xab, 0x4b, 0x96, 0x31, 0x62, 0xc4, 0x95, 0x37, 0x6e, 0xdc, 0xa5, 0x57, 0xae, 0x41, 0x82, 0x19, 0x32, 0x64, 0xc8, 0x8d, 0x7, 0xe, 0x1c, 0x38, 0x70, 0xe0, 0xdd, 0xa7, 0x53, 0xa6, 0x51, 0xa2, 0x59, 0xb2, 0x79, 0xf2, 0xf9, 0xef, 0xc3, 0x9b, 0x2b, 0x56, 0xac, 0x45, 0x8a, 0x9, 0x12, 0x24, 0x48, 0x90, 0x3d, 0x7a, 0xf4, 0xf5, 0xf7, 0xf3, 0xfb, 0xeb, 0xcb, 0x8b, 0xb, 0x16, 0x2c, 0x58, 0xb0, 0x7d, 0xfa, 0xe9, 0xcf, 0x83, 0x1b, 0x36, 0x6c, 0xd8, 0xad, 0x47, 0x8e}
var expTable = [256]byte{0x1, 0x2, 0x4, 0x8, 0x10, 0x20, 0x40, 0x80, 0x1d, 0x3a, 0x74, 0xe8, 0xcd, 0x87, 0x13, 0x26, 0x4c, 0x98, 0x2d, 0x5a, 0xb4, 0x75, 0xea, 0xc9, 0x8f, 0x3, 0x6, 0xc, 0x18, 0x30, 0x60, 0xc0, 0x9d, 0x27, 0x4e, 0x9c, 0x25, 0x4a, 0x94, 0x35, 0x6a, 0xd4, 0xb5, 0x77, 0xee, 0xc1, 0x9f, 0x23, 0x46, 0x8c, 0x5, 0xa, 0x14, 0x28, 0x50, 0xa0, 0x5d, 0xba, 0x69, 0xd2, 0xb9, 0x6f, 0xde, 0xa1, 0x5f, 0xbe, 0x61, 0xc2, 0x99, 0x2f, 0x5e, 0xbc, 0x65, 0xca, 0x89, 0xf, 0x1e, 0x3c, 0x78, 0xf0, 0xfd, 0xe7, 0xd3, 0xbb, 0x6b, 0xd6, 0xb1, 0x7f, 0xfe, 0xe1, 0xdf, 0xa3, 0x5b, 0xb6, 0x71, 0xe2, 0xd9, 0xaf, 0x43, 0x86, 0x11, 0x22, 0x44, 0x88, 0xd, 0x1a, 0x34, 0x68, 0xd0, 0xbd, 0x67, 0xce, 0x81, 0x1f, 0x3e, 0x7c, 0xf8, 0xed, 0xc7, 0x93, 0x3b, 0x76, 0xec, 0xc5, 0x97, 0x33, 0x66, 0xcc, 0x85, 0x17, 0x2e, 0x5c, 0xb8, 0x6d, 0xda, 0xa9, 0x4f, 0x9e, 0x21, 0x42, 0x84, 0x15, 0x2a, 0x54, 0xa8, 0x4d, 0x9a, 0x29, 0x52, 0xa4, 0x55, 0xaa, 0x49, 0x92, 0x39, 0x72, 0xe4, 0xd5, 0xb7, 0x73, 0xe6, 0xd1, 0xbf, 0x63, 0xc6, 0x91, 0x3f, 0x7e, 0xfc, 0xe5, 0xd7, 0xb3, 0x7b, 0xf6, 0xf1, 0xff, 0xe3, 0xdb, 0xab, 0x4b, 0x96, 0x31, 0x62, 0xc4, 0x95, 0x37, 0x6e, 0xdc, 0xa5, 0x57, 0xae, 0x41, 0x82, 0x19, 0x32, 0x64, 0xc8, 0x8d, 0x7, 0xe, 0x1c, 0x38, 0x70, 0xe0, 0xdd, 0xa7, 0x53, 0xa6, 0x51, 0xa2, 0x59, 0xb2, 0x79, 0xf2, 0xf9, 0xef, 0xc3, 0x9b, 0x2b, 0x56, 0xac, 0x45, 0x8a, 0x9, 0x12, 0x24, 0x48, 0x90, 0x3d, 0x7a, 0xf4, 0xf5, 0xf7, 0xf3, 0xfb, 0xeb, 0xcb, 0x8b, 0xb, 0x16, 0x2c, 0x58, 0xb0, 0x7d, 0xfa, 0xe9, 0xcf, 0x83, 0x1b, 0x36, 0x6c, 0xd8, 0xad, 0x47, 0x8e, 0x1}
func galAdd(a, b byte) byte {
return a ^ b
}
func galSub(a, b byte) byte {
return a ^ b
}
// Table from https://github.com/templexxx/reedsolomon
var invTable = [256]byte{0x0, 0x1, 0x8e, 0xf4, 0x47, 0xa7, 0x7a, 0xba, 0xad, 0x9d, 0xdd, 0x98, 0x3d, 0xaa, 0x5d, 0x96, 0xd8, 0x72, 0xc0, 0x58, 0xe0, 0x3e, 0x4c, 0x66, 0x90, 0xde, 0x55, 0x80, 0xa0, 0x83, 0x4b, 0x2a, 0x6c, 0xed, 0x39, 0x51, 0x60, 0x56, 0x2c, 0x8a, 0x70, 0xd0, 0x1f, 0x4a, 0x26, 0x8b, 0x33, 0x6e, 0x48, 0x89, 0x6f, 0x2e, 0xa4, 0xc3, 0x40, 0x5e, 0x50, 0x22, 0xcf, 0xa9, 0xab, 0xc, 0x15, 0xe1, 0x36, 0x5f, 0xf8, 0xd5, 0x92, 0x4e, 0xa6, 0x4, 0x30, 0x88, 0x2b, 0x1e, 0x16, 0x67, 0x45, 0x93, 0x38, 0x23, 0x68, 0x8c, 0x81, 0x1a, 0x25, 0x61, 0x13, 0xc1, 0xcb, 0x63, 0x97, 0xe, 0x37, 0x41, 0x24, 0x57, 0xca, 0x5b, 0xb9, 0xc4, 0x17, 0x4d, 0x52, 0x8d, 0xef, 0xb3, 0x20, 0xec, 0x2f, 0x32, 0x28, 0xd1, 0x11, 0xd9, 0xe9, 0xfb, 0xda, 0x79, 0xdb, 0x77, 0x6, 0xbb, 0x84, 0xcd, 0xfe, 0xfc, 0x1b, 0x54, 0xa1, 0x1d, 0x7c, 0xcc, 0xe4, 0xb0, 0x49, 0x31, 0x27, 0x2d, 0x53, 0x69, 0x2, 0xf5, 0x18, 0xdf, 0x44, 0x4f, 0x9b, 0xbc, 0xf, 0x5c, 0xb, 0xdc, 0xbd, 0x94, 0xac, 0x9, 0xc7, 0xa2, 0x1c, 0x82, 0x9f, 0xc6, 0x34, 0xc2, 0x46, 0x5, 0xce, 0x3b, 0xd, 0x3c, 0x9c, 0x8, 0xbe, 0xb7, 0x87, 0xe5, 0xee, 0x6b, 0xeb, 0xf2, 0xbf, 0xaf, 0xc5, 0x64, 0x7, 0x7b, 0x95, 0x9a, 0xae, 0xb6, 0x12, 0x59, 0xa5, 0x35, 0x65, 0xb8, 0xa3, 0x9e, 0xd2, 0xf7, 0x62, 0x5a, 0x85, 0x7d, 0xa8, 0x3a, 0x29, 0x71, 0xc8, 0xf6, 0xf9, 0x43, 0xd7, 0xd6, 0x10, 0x73, 0x76, 0x78, 0x99, 0xa, 0x19, 0x91, 0x14, 0x3f, 0xe6, 0xf0, 0x86, 0xb1, 0xe2, 0xf1, 0xfa, 0x74, 0xf3, 0xb4, 0x6d, 0x21, 0xb2, 0x6a, 0xe3, 0xe7, 0xb5, 0xea, 0x3, 0x8f, 0xd3, 0xc9, 0x42, 0xd4, 0xe8, 0x75, 0x7f, 0xff, 0x7e, 0xfd}
@@ -883,6 +879,15 @@ func galDivide(a, b byte) byte {
if logResult < 0 {
logResult += 255
}
return expTable[uint8(logResult)]
}
// galOneOver is the same as galDivide(1, a).
func galOneOver(a byte) byte {
if a == 0 {
panic("Argument 'divisor' is 0")
}
logResult := logTable[a] ^ 255
return expTable[logResult]
}
@@ -902,7 +907,7 @@ func galExp(a byte, n int) byte {
for logResult >= 255 {
logResult -= 255
}
return expTable[logResult]
return expTable[uint8(logResult)]
}
func genAvx2Matrix(matrixRows [][]byte, inputs, inIdx, outputs int, dst []byte) []byte {
+3 -11
View File
@@ -1,10 +1,11 @@
//go:build !noasm && !appengine && !gccgo
// +build !noasm,!appengine,!gccgo
//go:build !noasm && !appengine && !gccgo && !nopshufb
// Copyright 2015, Klaus Post, see LICENSE for details.
package reedsolomon
const pshufb = true
//go:noescape
func galMulSSSE3(low, high, in, out []byte)
@@ -17,21 +18,12 @@ func galMulAVX2Xor(low, high, in, out []byte)
//go:noescape
func galMulAVX2(low, high, in, out []byte)
//go:noescape
func sSE2XorSlice(in, out []byte)
//go:noescape
func galMulAVX2Xor_64(low, high, in, out []byte)
//go:noescape
func galMulAVX2_64(low, high, in, out []byte)
//go:noescape
func sSE2XorSlice_64(in, out []byte)
//go:noescape
func avx2XorSlice_64(in, out []byte)
// This is what the assembler routines do in blocks of 16 bytes:
/*
func galMulSSSE3(low, high, in, out []byte) {
+1 -85
View File
@@ -1,6 +1,7 @@
//+build !noasm
//+build !appengine
//+build !gccgo
//+build !nopshufb
// Copyright 2015, Klaus Post, see LICENSE for details.
@@ -215,28 +216,6 @@ done_avx2:
VZEROUPPER
RET
// func sSE2XorSlice(in, out []byte)
TEXT ·sSE2XorSlice(SB), 7, $0
MOVQ in+0(FP), SI // SI: &in
MOVQ in_len+8(FP), R9 // R9: len(in)
MOVQ out+24(FP), DX // DX: &out
SHRQ $4, R9 // len(in) / 16
CMPQ R9, $0
JEQ done_xor_sse2
loopback_xor_sse2:
MOVOU (SI), X0 // in[x]
MOVOU (DX), X1 // out[x]
PXOR X0, X1
MOVOU X1, (DX)
ADDQ $16, SI // in+=16
ADDQ $16, DX // out+=16
SUBQ $1, R9
JNZ loopback_xor_sse2
done_xor_sse2:
RET
// func galMulAVX2Xor_64(low, high, in, out []byte)
TEXT ·galMulAVX2Xor_64(SB), 7, $0
MOVQ low+0(FP), SI // SI: &low
@@ -329,66 +308,3 @@ loopback_avx2_64:
done_avx2_64:
VZEROUPPER
RET
// func sSE2XorSlice_64(in, out []byte)
TEXT ·sSE2XorSlice_64(SB), 7, $0
MOVQ in+0(FP), SI // SI: &in
MOVQ in_len+8(FP), R9 // R9: len(in)
MOVQ out+24(FP), DX // DX: &out
SHRQ $6, R9 // len(in) / 64
CMPQ R9, $0
JEQ done_xor_sse2_64
loopback_xor_sse2_64:
MOVOU (SI), X0 // in[x]
MOVOU 16(SI), X2 // in[x]
MOVOU 32(SI), X4 // in[x]
MOVOU 48(SI), X6 // in[x]
MOVOU (DX), X1 // out[x]
MOVOU 16(DX), X3 // out[x]
MOVOU 32(DX), X5 // out[x]
MOVOU 48(DX), X7 // out[x]
PXOR X0, X1
PXOR X2, X3
PXOR X4, X5
PXOR X6, X7
MOVOU X1, (DX)
MOVOU X3, 16(DX)
MOVOU X5, 32(DX)
MOVOU X7, 48(DX)
ADDQ $64, SI // in+=64
ADDQ $64, DX // out+=64
SUBQ $1, R9
JNZ loopback_xor_sse2_64
done_xor_sse2_64:
RET
// func avx2XorSlice_64(in, out []byte)
TEXT ·avx2XorSlice_64(SB), 7, $0
MOVQ in+0(FP), SI // SI: &in
MOVQ in_len+8(FP), R9 // R9: len(in)
MOVQ out+24(FP), DX // DX: &out
SHRQ $6, R9 // len(in) / 64
CMPQ R9, $0
JEQ done_xor_avx2_64
loopback_xor_avx2_64:
VMOVDQU (SI), Y0
VMOVDQU 32(SI), Y2
VMOVDQU (DX), Y1
VMOVDQU 32(DX), Y3
VPXOR Y0, Y1, Y1
VPXOR Y2, Y3, Y3
VMOVDQU Y1, (DX)
VMOVDQU Y3, 32(DX)
ADDQ $64, SI // in+=64
ADDQ $64, DX // out+=64
SUBQ $1, R9
JNZ loopback_xor_avx2_64
VZEROUPPER
done_xor_avx2_64:
RET
+5 -21
View File
@@ -1,20 +1,18 @@
//go:build !noasm && !appengine && !gccgo
// +build !noasm,!appengine,!gccgo
//go:build !noasm && !appengine && !gccgo && !nopshufb
// Copyright 2015, Klaus Post, see LICENSE for details.
// Copyright 2017, Minio, Inc.
package reedsolomon
const pshufb = true
//go:noescape
func galMulNEON(low, high, in, out []byte)
//go:noescape
func galMulXorNEON(low, high, in, out []byte)
//go:noescape
func galXorNEON(in, out []byte)
func galMulSlice(c byte, in, out []byte, o *options) {
if c == 1 {
copy(out, in)
@@ -51,20 +49,6 @@ func galMulSliceXor(c byte, in, out []byte, o *options) {
}
}
// simple slice xor
func sliceXor(in, out []byte, o *options) {
galXorNEON(in, out)
done := (len(in) >> 5) << 5
remain := len(in) - done
if remain > 0 {
for i := done; i < len(in); i++ {
out[i] ^= in[i]
}
}
}
// 4-way butterfly
func ifftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
ifftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
@@ -90,7 +74,7 @@ func fftDIT2(x, y []byte, log_m ffe, o *options) {
// Reference version:
refMulAdd(x, y, log_m)
// 64 byte aligned, always full.
galXorNEON(x, y)
xorSliceNEON(x, y)
}
// 2-way butterfly forward
@@ -103,7 +87,7 @@ func fftDIT28(x, y []byte, log_m ffe8, o *options) {
// 2-way butterfly
func ifftDIT2(x, y []byte, log_m ffe, o *options) {
// 64 byte aligned, always full.
galXorNEON(x, y)
xorSliceNEON(x, y)
// Reference version:
refMulAdd(x, y, log_m)
}
+1 -26
View File
@@ -1,6 +1,7 @@
//+build !noasm
//+build !appengine
//+build !gccgo
//+build !nopshufb
// Copyright 2015, Klaus Post, see LICENSE for details.
// Copyright 2017, Minio, Inc.
@@ -99,29 +100,3 @@ loopXor:
completeXor:
RET
// func galXorNEON(in, out []byte)
TEXT ·galXorNEON(SB), 7, $0
MOVD in_base+0(FP), R1
MOVD in_len+8(FP), R2 // length of message
MOVD out_base+24(FP), R5
SUBS $32, R2
BMI completeXor
loopXor:
// Main loop
VLD1.P 32(R1), [V0.B16, V1.B16]
VLD1 (R5), [V20.B16, V21.B16]
VEOR V20.B16, V0.B16, V4.B16
VEOR V21.B16, V1.B16, V5.B16
// Store result
VST1.P [V4.D2, V5.D2], 32(R5)
SUBS $32, R2
BPL loopXor
completeXor:
RET
+10 -1
View File
@@ -1,11 +1,20 @@
// Code generated by command: go run gen.go -out ../galois_gen_amd64.s -stubs ../galois_gen_amd64.go -pkg=reedsolomon. DO NOT EDIT.
//go:build !appengine && !noasm && !nogen && gc
//go:build !appengine && !noasm && !nogen && !nopshufb && gc
package reedsolomon
func _dummy_()
//go:noescape
func sSE2XorSlice(in []byte, out []byte)
//go:noescape
func sSE2XorSlice_64(in []byte, out []byte)
//go:noescape
func avx2XorSlice_64(in []byte, out []byte)
// mulAvxTwo_1x1 takes 1 inputs and produces 1 outputs.
// The output is initialized to 0.
//
+93 -1
View File
@@ -1,6 +1,6 @@
// Code generated by command: go run gen.go -out ../galois_gen_amd64.s -stubs ../galois_gen_amd64.go -pkg=reedsolomon. DO NOT EDIT.
//go:build !appengine && !noasm && !nogen && gc
//go:build !appengine && !noasm && !nogen && !nopshufb && gc
#include "textflag.h"
@@ -18,6 +18,98 @@ TEXT ·_dummy_(SB), $0
#endif
RET
// sSE2XorSlice will XOR in with out and store in out.
// Processes 16 bytes/loop.
// func sSE2XorSlice(in []byte, out []byte)
// Requires: SSE2
TEXT ·sSE2XorSlice(SB), $0-48
MOVQ in_base+0(FP), AX
MOVQ out_base+24(FP), CX
MOVQ in_len+8(FP), DX
SHRQ $0x04, DX
JZ end
loop:
MOVOU (AX), X0
MOVOU (CX), X1
PXOR X0, X1
MOVOU X1, (CX)
ADDQ $0x10, AX
ADDQ $0x10, CX
DECQ DX
JNZ loop
end:
RET
// sSE2XorSlice_64 will XOR in with out and store in out.
// Processes 64 bytes/loop.
// func sSE2XorSlice_64(in []byte, out []byte)
// Requires: SSE2
TEXT ·sSE2XorSlice_64(SB), $0-48
MOVQ in_base+0(FP), AX
MOVQ out_base+24(FP), CX
MOVQ in_len+8(FP), DX
SHRQ $0x06, DX
JZ end
loop:
MOVOU (AX), X0
MOVOU 16(AX), X2
MOVOU 32(AX), X4
MOVOU 48(AX), X6
MOVOU (CX), X1
MOVOU 16(CX), X3
MOVOU 32(CX), X5
MOVOU 48(CX), X7
PXOR X0, X1
PXOR X2, X3
PXOR X4, X5
PXOR X6, X7
MOVOU X1, (CX)
MOVOU X3, 16(CX)
MOVOU X5, 32(CX)
MOVOU X7, 48(CX)
ADDQ $0x40, AX
ADDQ $0x40, CX
DECQ DX
JNZ loop
end:
RET
// avx2XorSlice_64 will XOR in with out and store in out.
// Processes 64 bytes/loop.
// func avx2XorSlice_64(in []byte, out []byte)
// Requires: AVX, AVX2
TEXT ·avx2XorSlice_64(SB), $0-48
MOVQ in_base+0(FP), AX
MOVQ out_base+24(FP), CX
MOVQ in_len+8(FP), DX
SHRQ $0x06, DX
JZ end
loop:
VMOVDQU (AX), Y0
VMOVDQU 32(AX), Y2
VMOVDQU (CX), Y1
VMOVDQU 32(CX), Y3
VPXOR Y0, Y1, Y1
VPXOR Y2, Y3, Y3
VMOVDQU Y1, (CX)
VMOVDQU Y3, 32(CX)
ADDQ $0x40, AX
ADDQ $0x40, CX
DECQ DX
JNZ loop
end:
VZEROUPPER
RET
// func mulAvxTwo_1x1(matrix []byte, in [][]byte, out [][]byte, start int, n int)
// Requires: AVX, AVX2, SSE2
TEXT ·mulAvxTwo_1x1(SB), NOSPLIT, $0-88
-1
View File
@@ -1,5 +1,4 @@
//go:build !amd64 || noasm || appengine || gccgo || nogen
// +build !amd64 noasm appengine gccgo nogen
package reedsolomon
File diff suppressed because it is too large Load Diff
File diff suppressed because it is too large Load Diff
+2 -2
View File
@@ -1,7 +1,7 @@
// Code generated by command: go generate gen.go. DO NOT EDIT.
//go:build !appengine && !noasm && gc && !nogen
// +build !appengine,!noasm,gc,!nogen
//go:build !appengine && !noasm && gc && !nogen && !nopshufb
// +build !appengine,!noasm,gc,!nogen,!nopshufb
package reedsolomon
@@ -0,0 +1,697 @@
// Code generated by command: go generate gen.go. DO NOT EDIT.
//go:build !appengine && !noasm && gc && !nogen && nopshufb
// +build !appengine,!noasm,gc,!nogen,nopshufb
package reedsolomon
import (
"fmt"
)
const (
avx2CodeGen = true
maxAvx2Inputs = 10
maxAvx2Outputs = 10
minAvx2Size = 64
avxSizeMask = maxInt - (minAvx2Size - 1)
)
func galMulSlicesAvx2(matrix []byte, in, out [][]byte, start, stop int) int { panic(`no pshufb`) }
func galMulSlicesAvx2Xor(matrix []byte, in, out [][]byte, start, stop int) int { panic(`no pshufb`) }
func galMulSlicesGFNI(matrix []uint64, in, out [][]byte, start, stop int) int {
n := (stop - start) & avxSizeMask
switch len(in) {
case 1:
switch len(out) {
case 1:
mulGFNI_1x1_64(matrix, in, out, start, n)
return n
case 2:
mulGFNI_1x2_64(matrix, in, out, start, n)
return n
case 3:
mulGFNI_1x3_64(matrix, in, out, start, n)
return n
case 4:
mulGFNI_1x4_64(matrix, in, out, start, n)
return n
case 5:
mulGFNI_1x5_64(matrix, in, out, start, n)
return n
case 6:
mulGFNI_1x6_64(matrix, in, out, start, n)
return n
case 7:
mulGFNI_1x7_64(matrix, in, out, start, n)
return n
case 8:
mulGFNI_1x8_64(matrix, in, out, start, n)
return n
case 9:
mulGFNI_1x9_64(matrix, in, out, start, n)
return n
case 10:
mulGFNI_1x10_64(matrix, in, out, start, n)
return n
}
case 2:
switch len(out) {
case 1:
mulGFNI_2x1_64(matrix, in, out, start, n)
return n
case 2:
mulGFNI_2x2_64(matrix, in, out, start, n)
return n
case 3:
mulGFNI_2x3_64(matrix, in, out, start, n)
return n
case 4:
mulGFNI_2x4_64(matrix, in, out, start, n)
return n
case 5:
mulGFNI_2x5_64(matrix, in, out, start, n)
return n
case 6:
mulGFNI_2x6_64(matrix, in, out, start, n)
return n
case 7:
mulGFNI_2x7_64(matrix, in, out, start, n)
return n
case 8:
mulGFNI_2x8_64(matrix, in, out, start, n)
return n
case 9:
mulGFNI_2x9_64(matrix, in, out, start, n)
return n
case 10:
mulGFNI_2x10_64(matrix, in, out, start, n)
return n
}
case 3:
switch len(out) {
case 1:
mulGFNI_3x1_64(matrix, in, out, start, n)
return n
case 2:
mulGFNI_3x2_64(matrix, in, out, start, n)
return n
case 3:
mulGFNI_3x3_64(matrix, in, out, start, n)
return n
case 4:
mulGFNI_3x4_64(matrix, in, out, start, n)
return n
case 5:
mulGFNI_3x5_64(matrix, in, out, start, n)
return n
case 6:
mulGFNI_3x6_64(matrix, in, out, start, n)
return n
case 7:
mulGFNI_3x7_64(matrix, in, out, start, n)
return n
case 8:
mulGFNI_3x8_64(matrix, in, out, start, n)
return n
case 9:
mulGFNI_3x9_64(matrix, in, out, start, n)
return n
case 10:
mulGFNI_3x10_64(matrix, in, out, start, n)
return n
}
case 4:
switch len(out) {
case 1:
mulGFNI_4x1_64(matrix, in, out, start, n)
return n
case 2:
mulGFNI_4x2_64(matrix, in, out, start, n)
return n
case 3:
mulGFNI_4x3_64(matrix, in, out, start, n)
return n
case 4:
mulGFNI_4x4_64(matrix, in, out, start, n)
return n
case 5:
mulGFNI_4x5_64(matrix, in, out, start, n)
return n
case 6:
mulGFNI_4x6_64(matrix, in, out, start, n)
return n
case 7:
mulGFNI_4x7_64(matrix, in, out, start, n)
return n
case 8:
mulGFNI_4x8_64(matrix, in, out, start, n)
return n
case 9:
mulGFNI_4x9_64(matrix, in, out, start, n)
return n
case 10:
mulGFNI_4x10_64(matrix, in, out, start, n)
return n
}
case 5:
switch len(out) {
case 1:
mulGFNI_5x1_64(matrix, in, out, start, n)
return n
case 2:
mulGFNI_5x2_64(matrix, in, out, start, n)
return n
case 3:
mulGFNI_5x3_64(matrix, in, out, start, n)
return n
case 4:
mulGFNI_5x4_64(matrix, in, out, start, n)
return n
case 5:
mulGFNI_5x5_64(matrix, in, out, start, n)
return n
case 6:
mulGFNI_5x6_64(matrix, in, out, start, n)
return n
case 7:
mulGFNI_5x7_64(matrix, in, out, start, n)
return n
case 8:
mulGFNI_5x8_64(matrix, in, out, start, n)
return n
case 9:
mulGFNI_5x9_64(matrix, in, out, start, n)
return n
case 10:
mulGFNI_5x10_64(matrix, in, out, start, n)
return n
}
case 6:
switch len(out) {
case 1:
mulGFNI_6x1_64(matrix, in, out, start, n)
return n
case 2:
mulGFNI_6x2_64(matrix, in, out, start, n)
return n
case 3:
mulGFNI_6x3_64(matrix, in, out, start, n)
return n
case 4:
mulGFNI_6x4_64(matrix, in, out, start, n)
return n
case 5:
mulGFNI_6x5_64(matrix, in, out, start, n)
return n
case 6:
mulGFNI_6x6_64(matrix, in, out, start, n)
return n
case 7:
mulGFNI_6x7_64(matrix, in, out, start, n)
return n
case 8:
mulGFNI_6x8_64(matrix, in, out, start, n)
return n
case 9:
mulGFNI_6x9_64(matrix, in, out, start, n)
return n
case 10:
mulGFNI_6x10_64(matrix, in, out, start, n)
return n
}
case 7:
switch len(out) {
case 1:
mulGFNI_7x1_64(matrix, in, out, start, n)
return n
case 2:
mulGFNI_7x2_64(matrix, in, out, start, n)
return n
case 3:
mulGFNI_7x3_64(matrix, in, out, start, n)
return n
case 4:
mulGFNI_7x4_64(matrix, in, out, start, n)
return n
case 5:
mulGFNI_7x5_64(matrix, in, out, start, n)
return n
case 6:
mulGFNI_7x6_64(matrix, in, out, start, n)
return n
case 7:
mulGFNI_7x7_64(matrix, in, out, start, n)
return n
case 8:
mulGFNI_7x8_64(matrix, in, out, start, n)
return n
case 9:
mulGFNI_7x9_64(matrix, in, out, start, n)
return n
case 10:
mulGFNI_7x10_64(matrix, in, out, start, n)
return n
}
case 8:
switch len(out) {
case 1:
mulGFNI_8x1_64(matrix, in, out, start, n)
return n
case 2:
mulGFNI_8x2_64(matrix, in, out, start, n)
return n
case 3:
mulGFNI_8x3_64(matrix, in, out, start, n)
return n
case 4:
mulGFNI_8x4_64(matrix, in, out, start, n)
return n
case 5:
mulGFNI_8x5_64(matrix, in, out, start, n)
return n
case 6:
mulGFNI_8x6_64(matrix, in, out, start, n)
return n
case 7:
mulGFNI_8x7_64(matrix, in, out, start, n)
return n
case 8:
mulGFNI_8x8_64(matrix, in, out, start, n)
return n
case 9:
mulGFNI_8x9_64(matrix, in, out, start, n)
return n
case 10:
mulGFNI_8x10_64(matrix, in, out, start, n)
return n
}
case 9:
switch len(out) {
case 1:
mulGFNI_9x1_64(matrix, in, out, start, n)
return n
case 2:
mulGFNI_9x2_64(matrix, in, out, start, n)
return n
case 3:
mulGFNI_9x3_64(matrix, in, out, start, n)
return n
case 4:
mulGFNI_9x4_64(matrix, in, out, start, n)
return n
case 5:
mulGFNI_9x5_64(matrix, in, out, start, n)
return n
case 6:
mulGFNI_9x6_64(matrix, in, out, start, n)
return n
case 7:
mulGFNI_9x7_64(matrix, in, out, start, n)
return n
case 8:
mulGFNI_9x8_64(matrix, in, out, start, n)
return n
case 9:
mulGFNI_9x9_64(matrix, in, out, start, n)
return n
case 10:
mulGFNI_9x10_64(matrix, in, out, start, n)
return n
}
case 10:
switch len(out) {
case 1:
mulGFNI_10x1_64(matrix, in, out, start, n)
return n
case 2:
mulGFNI_10x2_64(matrix, in, out, start, n)
return n
case 3:
mulGFNI_10x3_64(matrix, in, out, start, n)
return n
case 4:
mulGFNI_10x4_64(matrix, in, out, start, n)
return n
case 5:
mulGFNI_10x5_64(matrix, in, out, start, n)
return n
case 6:
mulGFNI_10x6_64(matrix, in, out, start, n)
return n
case 7:
mulGFNI_10x7_64(matrix, in, out, start, n)
return n
case 8:
mulGFNI_10x8_64(matrix, in, out, start, n)
return n
case 9:
mulGFNI_10x9_64(matrix, in, out, start, n)
return n
case 10:
mulGFNI_10x10_64(matrix, in, out, start, n)
return n
}
}
panic(fmt.Sprintf("unhandled size: %dx%d", len(in), len(out)))
}
func galMulSlicesGFNIXor(matrix []uint64, in, out [][]byte, start, stop int) int {
n := (stop - start) & avxSizeMask
switch len(in) {
case 1:
switch len(out) {
case 1:
mulGFNI_1x1_64Xor(matrix, in, out, start, n)
return n
case 2:
mulGFNI_1x2_64Xor(matrix, in, out, start, n)
return n
case 3:
mulGFNI_1x3_64Xor(matrix, in, out, start, n)
return n
case 4:
mulGFNI_1x4_64Xor(matrix, in, out, start, n)
return n
case 5:
mulGFNI_1x5_64Xor(matrix, in, out, start, n)
return n
case 6:
mulGFNI_1x6_64Xor(matrix, in, out, start, n)
return n
case 7:
mulGFNI_1x7_64Xor(matrix, in, out, start, n)
return n
case 8:
mulGFNI_1x8_64Xor(matrix, in, out, start, n)
return n
case 9:
mulGFNI_1x9_64Xor(matrix, in, out, start, n)
return n
case 10:
mulGFNI_1x10_64Xor(matrix, in, out, start, n)
return n
}
case 2:
switch len(out) {
case 1:
mulGFNI_2x1_64Xor(matrix, in, out, start, n)
return n
case 2:
mulGFNI_2x2_64Xor(matrix, in, out, start, n)
return n
case 3:
mulGFNI_2x3_64Xor(matrix, in, out, start, n)
return n
case 4:
mulGFNI_2x4_64Xor(matrix, in, out, start, n)
return n
case 5:
mulGFNI_2x5_64Xor(matrix, in, out, start, n)
return n
case 6:
mulGFNI_2x6_64Xor(matrix, in, out, start, n)
return n
case 7:
mulGFNI_2x7_64Xor(matrix, in, out, start, n)
return n
case 8:
mulGFNI_2x8_64Xor(matrix, in, out, start, n)
return n
case 9:
mulGFNI_2x9_64Xor(matrix, in, out, start, n)
return n
case 10:
mulGFNI_2x10_64Xor(matrix, in, out, start, n)
return n
}
case 3:
switch len(out) {
case 1:
mulGFNI_3x1_64Xor(matrix, in, out, start, n)
return n
case 2:
mulGFNI_3x2_64Xor(matrix, in, out, start, n)
return n
case 3:
mulGFNI_3x3_64Xor(matrix, in, out, start, n)
return n
case 4:
mulGFNI_3x4_64Xor(matrix, in, out, start, n)
return n
case 5:
mulGFNI_3x5_64Xor(matrix, in, out, start, n)
return n
case 6:
mulGFNI_3x6_64Xor(matrix, in, out, start, n)
return n
case 7:
mulGFNI_3x7_64Xor(matrix, in, out, start, n)
return n
case 8:
mulGFNI_3x8_64Xor(matrix, in, out, start, n)
return n
case 9:
mulGFNI_3x9_64Xor(matrix, in, out, start, n)
return n
case 10:
mulGFNI_3x10_64Xor(matrix, in, out, start, n)
return n
}
case 4:
switch len(out) {
case 1:
mulGFNI_4x1_64Xor(matrix, in, out, start, n)
return n
case 2:
mulGFNI_4x2_64Xor(matrix, in, out, start, n)
return n
case 3:
mulGFNI_4x3_64Xor(matrix, in, out, start, n)
return n
case 4:
mulGFNI_4x4_64Xor(matrix, in, out, start, n)
return n
case 5:
mulGFNI_4x5_64Xor(matrix, in, out, start, n)
return n
case 6:
mulGFNI_4x6_64Xor(matrix, in, out, start, n)
return n
case 7:
mulGFNI_4x7_64Xor(matrix, in, out, start, n)
return n
case 8:
mulGFNI_4x8_64Xor(matrix, in, out, start, n)
return n
case 9:
mulGFNI_4x9_64Xor(matrix, in, out, start, n)
return n
case 10:
mulGFNI_4x10_64Xor(matrix, in, out, start, n)
return n
}
case 5:
switch len(out) {
case 1:
mulGFNI_5x1_64Xor(matrix, in, out, start, n)
return n
case 2:
mulGFNI_5x2_64Xor(matrix, in, out, start, n)
return n
case 3:
mulGFNI_5x3_64Xor(matrix, in, out, start, n)
return n
case 4:
mulGFNI_5x4_64Xor(matrix, in, out, start, n)
return n
case 5:
mulGFNI_5x5_64Xor(matrix, in, out, start, n)
return n
case 6:
mulGFNI_5x6_64Xor(matrix, in, out, start, n)
return n
case 7:
mulGFNI_5x7_64Xor(matrix, in, out, start, n)
return n
case 8:
mulGFNI_5x8_64Xor(matrix, in, out, start, n)
return n
case 9:
mulGFNI_5x9_64Xor(matrix, in, out, start, n)
return n
case 10:
mulGFNI_5x10_64Xor(matrix, in, out, start, n)
return n
}
case 6:
switch len(out) {
case 1:
mulGFNI_6x1_64Xor(matrix, in, out, start, n)
return n
case 2:
mulGFNI_6x2_64Xor(matrix, in, out, start, n)
return n
case 3:
mulGFNI_6x3_64Xor(matrix, in, out, start, n)
return n
case 4:
mulGFNI_6x4_64Xor(matrix, in, out, start, n)
return n
case 5:
mulGFNI_6x5_64Xor(matrix, in, out, start, n)
return n
case 6:
mulGFNI_6x6_64Xor(matrix, in, out, start, n)
return n
case 7:
mulGFNI_6x7_64Xor(matrix, in, out, start, n)
return n
case 8:
mulGFNI_6x8_64Xor(matrix, in, out, start, n)
return n
case 9:
mulGFNI_6x9_64Xor(matrix, in, out, start, n)
return n
case 10:
mulGFNI_6x10_64Xor(matrix, in, out, start, n)
return n
}
case 7:
switch len(out) {
case 1:
mulGFNI_7x1_64Xor(matrix, in, out, start, n)
return n
case 2:
mulGFNI_7x2_64Xor(matrix, in, out, start, n)
return n
case 3:
mulGFNI_7x3_64Xor(matrix, in, out, start, n)
return n
case 4:
mulGFNI_7x4_64Xor(matrix, in, out, start, n)
return n
case 5:
mulGFNI_7x5_64Xor(matrix, in, out, start, n)
return n
case 6:
mulGFNI_7x6_64Xor(matrix, in, out, start, n)
return n
case 7:
mulGFNI_7x7_64Xor(matrix, in, out, start, n)
return n
case 8:
mulGFNI_7x8_64Xor(matrix, in, out, start, n)
return n
case 9:
mulGFNI_7x9_64Xor(matrix, in, out, start, n)
return n
case 10:
mulGFNI_7x10_64Xor(matrix, in, out, start, n)
return n
}
case 8:
switch len(out) {
case 1:
mulGFNI_8x1_64Xor(matrix, in, out, start, n)
return n
case 2:
mulGFNI_8x2_64Xor(matrix, in, out, start, n)
return n
case 3:
mulGFNI_8x3_64Xor(matrix, in, out, start, n)
return n
case 4:
mulGFNI_8x4_64Xor(matrix, in, out, start, n)
return n
case 5:
mulGFNI_8x5_64Xor(matrix, in, out, start, n)
return n
case 6:
mulGFNI_8x6_64Xor(matrix, in, out, start, n)
return n
case 7:
mulGFNI_8x7_64Xor(matrix, in, out, start, n)
return n
case 8:
mulGFNI_8x8_64Xor(matrix, in, out, start, n)
return n
case 9:
mulGFNI_8x9_64Xor(matrix, in, out, start, n)
return n
case 10:
mulGFNI_8x10_64Xor(matrix, in, out, start, n)
return n
}
case 9:
switch len(out) {
case 1:
mulGFNI_9x1_64Xor(matrix, in, out, start, n)
return n
case 2:
mulGFNI_9x2_64Xor(matrix, in, out, start, n)
return n
case 3:
mulGFNI_9x3_64Xor(matrix, in, out, start, n)
return n
case 4:
mulGFNI_9x4_64Xor(matrix, in, out, start, n)
return n
case 5:
mulGFNI_9x5_64Xor(matrix, in, out, start, n)
return n
case 6:
mulGFNI_9x6_64Xor(matrix, in, out, start, n)
return n
case 7:
mulGFNI_9x7_64Xor(matrix, in, out, start, n)
return n
case 8:
mulGFNI_9x8_64Xor(matrix, in, out, start, n)
return n
case 9:
mulGFNI_9x9_64Xor(matrix, in, out, start, n)
return n
case 10:
mulGFNI_9x10_64Xor(matrix, in, out, start, n)
return n
}
case 10:
switch len(out) {
case 1:
mulGFNI_10x1_64Xor(matrix, in, out, start, n)
return n
case 2:
mulGFNI_10x2_64Xor(matrix, in, out, start, n)
return n
case 3:
mulGFNI_10x3_64Xor(matrix, in, out, start, n)
return n
case 4:
mulGFNI_10x4_64Xor(matrix, in, out, start, n)
return n
case 5:
mulGFNI_10x5_64Xor(matrix, in, out, start, n)
return n
case 6:
mulGFNI_10x6_64Xor(matrix, in, out, start, n)
return n
case 7:
mulGFNI_10x7_64Xor(matrix, in, out, start, n)
return n
case 8:
mulGFNI_10x8_64Xor(matrix, in, out, start, n)
return n
case 9:
mulGFNI_10x9_64Xor(matrix, in, out, start, n)
return n
case 10:
mulGFNI_10x10_64Xor(matrix, in, out, start, n)
return n
}
}
panic(fmt.Sprintf("unhandled size: %dx%d", len(in), len(out)))
}
+3 -9
View File
@@ -1,12 +1,11 @@
//go:build (!amd64 || noasm || appengine || gccgo) && (!arm64 || noasm || appengine || gccgo) && (!ppc64le || noasm || appengine || gccgo)
// +build !amd64 noasm appengine gccgo
// +build !arm64 noasm appengine gccgo
// +build !ppc64le noasm appengine gccgo
//go:build (!amd64 || noasm || appengine || gccgo) && (!arm64 || noasm || appengine || gccgo || nopshufb) && (!ppc64le || noasm || appengine || gccgo || nopshufb)
// Copyright 2015, Klaus Post, see LICENSE for details.
package reedsolomon
const pshufb = false
func galMulSlice(c byte, in, out []byte, o *options) {
out = out[:len(in)]
if c == 1 {
@@ -31,11 +30,6 @@ func galMulSliceXor(c byte, in, out []byte, o *options) {
}
}
// simple slice xor
func sliceXor(in, out []byte, o *options) {
sliceXorGo(in, out, o)
}
func init() {
defaultOptions.useAVX512 = false
}
+146
View File
@@ -0,0 +1,146 @@
// Copyright 2015, Klaus Post, see LICENSE for details
//go:build nopshufb && !noasm
package reedsolomon
// bigSwitchover is the size where 64 bytes are processed per loop.
const bigSwitchover = 128
const pshufb = false
// simple slice xor
func sliceXor(in, out []byte, o *options) {
if o.useSSE2 {
if len(in) >= bigSwitchover {
if o.useAVX2 {
avx2XorSlice_64(in, out)
done := (len(in) >> 6) << 6
in = in[done:]
out = out[done:]
} else {
sSE2XorSlice_64(in, out)
done := (len(in) >> 6) << 6
in = in[done:]
out = out[done:]
}
}
if len(in) >= 16 {
sSE2XorSlice(in, out)
done := (len(in) >> 4) << 4
in = in[done:]
out = out[done:]
}
} else {
sliceXorGo(in, out, o)
return
}
out = out[:len(in)]
for i := range in {
out[i] ^= in[i]
}
}
func galMulSlice(c byte, in, out []byte, o *options) {
out = out[:len(in)]
if c == 1 {
copy(out, in)
return
}
mt := mulTable[c][:256]
for len(in) >= 4 {
ii := (*[4]byte)(in)
oo := (*[4]byte)(out)
oo[0] = mt[ii[0]]
oo[1] = mt[ii[1]]
oo[2] = mt[ii[2]]
oo[3] = mt[ii[3]]
in = in[4:]
out = out[4:]
}
for n, input := range in {
out[n] = mt[input]
}
}
func galMulSliceXor(c byte, in, out []byte, o *options) {
out = out[:len(in)]
if c == 1 {
sliceXor(in, out, o)
return
}
mt := mulTable[c][:256]
for len(in) >= 4 {
ii := (*[4]byte)(in)
oo := (*[4]byte)(out)
oo[0] ^= mt[ii[0]]
oo[1] ^= mt[ii[1]]
oo[2] ^= mt[ii[2]]
oo[3] ^= mt[ii[3]]
in = in[4:]
out = out[4:]
}
for n, input := range in {
out[n] ^= mt[input]
}
}
func init() {
defaultOptions.useAVX512 = false
}
// 4-way butterfly
func ifftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
ifftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
}
// 4-way butterfly
func ifftDIT48(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe8, o *options) {
ifftDIT4Ref8(work, dist, log_m01, log_m23, log_m02, o)
}
// 4-way butterfly
func fftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
fftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
}
// 4-way butterfly
func fftDIT48(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe8, o *options) {
fftDIT4Ref8(work, dist, log_m01, log_m23, log_m02, o)
}
// 2-way butterfly forward
func fftDIT2(x, y []byte, log_m ffe, o *options) {
// Reference version:
refMulAdd(x, y, log_m)
sliceXor(x, y, o)
}
// 2-way butterfly forward
func fftDIT28(x, y []byte, log_m ffe8, o *options) {
// Reference version:
refMulAdd8(x, y, log_m)
sliceXor(x, y, o)
}
// 2-way butterfly inverse
func ifftDIT2(x, y []byte, log_m ffe, o *options) {
// Reference version:
sliceXor(x, y, o)
refMulAdd(x, y, log_m)
}
// 2-way butterfly inverse
func ifftDIT28(x, y []byte, log_m ffe8, o *options) {
// Reference version:
sliceXor(x, y, o)
refMulAdd8(x, y, log_m)
}
func mulgf16(x, y []byte, log_m ffe, o *options) {
refMul(x, y, log_m)
}
func mulgf8(x, y []byte, log_m ffe8, o *options) {
refMul8(x, y, log_m)
}
+1 -2
View File
@@ -1,5 +1,4 @@
//go:build !amd64 || noasm || appengine || gccgo
// +build !amd64 noasm appengine gccgo
//go:build !amd64 || noasm || appengine || gccgo || pshufb
// Copyright 2020, Klaus Post, see LICENSE for details.
+3 -7
View File
@@ -1,11 +1,12 @@
//go:build !noasm && !appengine && !gccgo
// +build !noasm,!appengine,!gccgo
//go:build !noasm && !appengine && !gccgo && !nopshufb
// Copyright 2015, Klaus Post, see LICENSE for details.
// Copyright 2018, Minio, Inc.
package reedsolomon
const pshufb = true
//go:noescape
func galMulPpc(low, high, in, out []byte)
@@ -66,11 +67,6 @@ func galMulSliceXor(c byte, in, out []byte, o *options) {
}
}
// slice galois add
func sliceXor(in, out []byte, o *options) {
sliceXorGo(in, out, o)
}
// 4-way butterfly
func ifftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
ifftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
+1
View File
@@ -1,6 +1,7 @@
//+build !noasm
//+build !appengine
//+build !gccgo
//+build !pshufb
// Copyright 2015, Klaus Post, see LICENSE for details.
// Copyright 2018, Minio, Inc.
+1 -1
View File
@@ -303,7 +303,7 @@ func (r *leopardFF16) Split(data []byte) ([][]byte, error) {
// Copy partial shards
copyFrom := data[perShard*fullShards : dataLen]
for i := range padding {
if len(copyFrom) <= 0 {
if len(copyFrom) == 0 {
break
}
copyFrom = copyFrom[copy(padding[i], copyFrom):]
+1 -1
View File
@@ -344,7 +344,7 @@ func (r *leopardFF8) Split(data []byte) ([][]byte, error) {
// Copy partial shards
copyFrom := data[perShard*fullShards : dataLen]
for i := range padding {
if len(copyFrom) <= 0 {
if len(copyFrom) == 0 {
break
}
copyFrom = copyFrom[copy(padding[i], copyFrom):]
+3 -3
View File
@@ -67,11 +67,11 @@ var errColSizeMismatch = errors.New("column size is not the same for all rows")
func (m matrix) Check() error {
rows := len(m)
if rows <= 0 {
if rows == 0 {
return errInvalidRowSize
}
cols := len(m[0])
if cols <= 0 {
if cols == 0 {
return errInvalidColSize
}
@@ -231,7 +231,7 @@ func (m matrix) gaussianElimination() error {
}
// Scale to 1.
if m[r][r] != 1 {
scale := galDivide(1, m[r][r])
scale := galOneOver(m[r][r])
for c := 0; c < columns; c++ {
m[r][c] = galMultiply(m[r][c], scale)
}
+6 -6
View File
@@ -283,7 +283,7 @@ func buildMatrixJerasure(dataShards, totalShards int) (matrix, error) {
// Multiply by the inverted matrix (same as vm.Multiply(vm[0:dataShards].Invert()))
if vm[i][i] != 1 {
// Make vm[i][i] = 1 by dividing the column by vm[i][i]
tmp := galDivide(1, vm[i][i])
tmp := galOneOver(vm[i][i])
for j := 0; j < totalShards; j++ {
vm[j][i] = galMultiply(vm[j][i], tmp)
}
@@ -303,7 +303,7 @@ func buildMatrixJerasure(dataShards, totalShards int) (matrix, error) {
for j := 0; j < dataShards; j++ {
tmp := vm[dataShards][j]
if tmp != 1 {
tmp = galDivide(1, tmp)
tmp = galOneOver(tmp)
for i := dataShards; i < totalShards; i++ {
vm[i][j] = galMultiply(vm[i][j], tmp)
}
@@ -314,7 +314,7 @@ func buildMatrixJerasure(dataShards, totalShards int) (matrix, error) {
for i := dataShards + 1; i < totalShards; i++ {
tmp := vm[i][0]
if tmp != 1 {
tmp = galDivide(1, tmp)
tmp = galOneOver(tmp)
for j := 0; j < dataShards; j++ {
vm[i][j] = galMultiply(vm[i][j], tmp)
}
@@ -652,7 +652,7 @@ func (r *reedSolomon) EncodeIdx(dataShard []byte, idx int, parity [][]byte) erro
return ErrShardSize
}
if avx2CodeGen && len(dataShard) >= r.o.perRound && len(parity) >= avx2CodeGenMinShards && (r.o.useAVX2 || r.o.useGFNI) {
if avx2CodeGen && len(dataShard) >= r.o.perRound && len(parity) >= avx2CodeGenMinShards && ((pshufb && r.o.useAVX2) || r.o.useGFNI) {
m := make([][]byte, r.parityShards)
for iRow := range m {
m[iRow] = r.parity[iRow][idx : idx+1]
@@ -803,7 +803,7 @@ func (r *reedSolomon) Verify(shards [][]byte) (bool, error) {
}
func (r *reedSolomon) canAVX2C(byteCount int, inputs, outputs int) bool {
return avx2CodeGen && r.o.useAVX2 &&
return avx2CodeGen && pshufb && r.o.useAVX2 &&
byteCount >= avx2CodeGenMinSize && inputs+outputs >= avx2CodeGenMinShards &&
inputs <= maxAvx2Inputs && outputs <= maxAvx2Outputs
}
@@ -1633,7 +1633,7 @@ func (r *reedSolomon) Split(data []byte) ([][]byte, error) {
// Copy partial shards
copyFrom := data[perShard*fullShards : dataLen]
for i := range padding {
if len(copyFrom) <= 0 {
if len(copyFrom) == 0 {
break
}
copyFrom = copyFrom[copy(padding[i], copyFrom):]
+19
View File
@@ -0,0 +1,19 @@
//go:build !noasm && !appengine && !gccgo
package reedsolomon
//go:noescape
func xorSliceNEON(in, out []byte)
// simple slice xor
func sliceXor(in, out []byte, o *options) {
xorSliceNEON(in, out)
done := (len(in) >> 5) << 5
remain := len(in) - done
if remain > 0 {
for i := done; i < len(in); i++ {
out[i] ^= in[i]
}
}
}
+29
View File
@@ -0,0 +1,29 @@
//+build !noasm
//+build !appengine
//+build !gccgo
// func xorSliceNEON(in, out []byte)
TEXT ·xorSliceNEON(SB), 7, $0
MOVD in_base+0(FP), R1
MOVD in_len+8(FP), R2 // length of message
MOVD out_base+24(FP), R5
SUBS $32, R2
BMI completeXor
loopXor:
// Main loop
VLD1.P 32(R1), [V0.B16, V1.B16]
VLD1 (R5), [V20.B16, V21.B16]
VEOR V20.B16, V0.B16, V4.B16
VEOR V21.B16, V1.B16, V5.B16
// Store result
VST1.P [V4.D2, V5.D2], 32(R5)
SUBS $32, R2
BPL loopXor
completeXor:
RET
+7
View File
@@ -0,0 +1,7 @@
//go:build noasm || gccgo || appengine || (!amd64 && !arm64)
package reedsolomon
func sliceXor(in, out []byte, o *options) {
sliceXorGo(in, out, o)
}
+28 -20
View File
@@ -3,6 +3,7 @@ package kcp
import (
"encoding/binary"
"sync/atomic"
"time"
"github.com/klauspost/reedsolomon"
)
@@ -278,8 +279,9 @@ type (
payloadOffset int // FEC payload offset
// caches
shardCache [][]byte
encodeCache [][]byte
shardCache [][]byte
encodeCache [][]byte
tsLatestPacket int64
// RS encoder
codec reedsolomon.Encoder
@@ -315,7 +317,7 @@ func newFECEncoder(dataShards, parityShards, offset int) *fecEncoder {
// encodes the packet, outputs parity shards if we have collected quorum datashards
// notice: the contents of 'ps' will be re-written in successive calling
func (enc *fecEncoder) encode(b []byte) (ps [][]byte) {
func (enc *fecEncoder) encode(b []byte, rto uint32) (ps [][]byte) {
// The header format:
// | FEC SEQID(4B) | FEC TYPE(2B) | SIZE (2B) | PAYLOAD(SIZE-2) |
// |<-headerOffset |<-payloadOffset
@@ -334,26 +336,30 @@ func (enc *fecEncoder) encode(b []byte) (ps [][]byte) {
}
// Generation of Reed-Solomon Erasure Code
now := time.Now().UnixMilli()
if enc.shardCount == enc.dataShards {
// fill '0' into the tail of each datashard
for i := 0; i < enc.dataShards; i++ {
shard := enc.shardCache[i]
slen := len(shard)
clear(shard[slen:enc.maxSize])
}
// generate the rs-code only if the data is continuous.
if now-enc.tsLatestPacket < int64(rto) {
// fill '0' into the tail of each datashard
for i := 0; i < enc.dataShards; i++ {
shard := enc.shardCache[i]
slen := len(shard)
clear(shard[slen:enc.maxSize])
}
// construct equal-sized slice with stripped header
cache := enc.encodeCache
for k := range cache {
cache[k] = enc.shardCache[k][enc.payloadOffset:enc.maxSize]
}
// construct equal-sized slice with stripped header
cache := enc.encodeCache
for k := range cache {
cache[k] = enc.shardCache[k][enc.payloadOffset:enc.maxSize]
}
// encoding
if err := enc.codec.Encode(cache); err == nil {
ps = enc.shardCache[enc.dataShards:]
for k := range ps {
enc.markParity(ps[k][enc.headerOffset:])
ps[k] = ps[k][:enc.maxSize]
// encoding
if err := enc.codec.Encode(cache); err == nil {
ps = enc.shardCache[enc.dataShards:]
for k := range ps {
enc.markParity(ps[k][enc.headerOffset:])
ps[k] = ps[k][:enc.maxSize]
}
}
}
@@ -362,6 +368,8 @@ func (enc *fecEncoder) encode(b []byte) (ps [][]byte) {
enc.maxSize = 0
}
enc.tsLatestPacket = now
return
}
+1 -1
View File
@@ -531,7 +531,7 @@ func (s *UDPSession) output(buf []byte) {
// 1. FEC encoding
if s.fecEncoder != nil {
ecc = s.fecEncoder.encode(buf)
ecc = s.fecEncoder.encode(buf, s.kcp.rx_rto)
}
// 2&3. crc32 & encryption
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !purego
// +build !purego
// Package alias implements memory aliasing tests.
package alias
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build purego
// +build purego
// Package alias implements memory aliasing tests.
package alias
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build amd64 && !purego && gc
// +build amd64,!purego,gc
package salsa
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build amd64 && !purego && gc
// +build amd64,!purego,gc
// This code was translated into a form compatible with 6a from the public
// domain sources in SUPERCOP: https://bench.cr.yp.to/supercop.html
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !amd64 || purego || !gc
// +build !amd64 purego !gc
package salsa
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build aix || darwin || dragonfly || freebsd || netbsd || openbsd
// +build aix darwin dragonfly freebsd netbsd openbsd
package socket
-2
View File
@@ -3,8 +3,6 @@
// license that can be found in the LICENSE file.
//go:build (arm || mips || mipsle || 386 || ppc) && linux
// +build arm mips mipsle 386 ppc
// +build linux
package socket
-2
View File
@@ -3,8 +3,6 @@
// license that can be found in the LICENSE file.
//go:build (arm64 || amd64 || loong64 || ppc64 || ppc64le || mips64 || mips64le || riscv64 || s390x) && linux
// +build arm64 amd64 loong64 ppc64 ppc64le mips64 mips64le riscv64 s390x
// +build linux
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build amd64 && solaris
// +build amd64,solaris
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !zos
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!zos
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris
// +build darwin dragonfly freebsd linux netbsd openbsd solaris
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build aix || windows || zos
// +build aix windows zos
package socket
-1
View File
@@ -3,6 +3,5 @@
// license that can be found in the LICENSE file.
//go:build darwin && go1.12
// +build darwin,go1.12
// This exists solely so we can linkname in symbols from syscall.
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
package socket
-2
View File
@@ -3,8 +3,6 @@
// license that can be found in the LICENSE file.
//go:build (arm || mips || mipsle || 386 || ppc) && (darwin || dragonfly || freebsd || linux || netbsd || openbsd)
// +build arm mips mipsle 386 ppc
// +build darwin dragonfly freebsd linux netbsd openbsd
package socket
-2
View File
@@ -3,8 +3,6 @@
// license that can be found in the LICENSE file.
//go:build (arm64 || amd64 || loong64 || ppc64 || ppc64le || mips64 || mips64le || riscv64 || s390x) && (aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || zos)
// +build arm64 amd64 loong64 ppc64 ppc64le mips64 mips64le riscv64 s390x
// +build aix darwin dragonfly freebsd linux netbsd openbsd zos
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build amd64 && solaris
// +build amd64,solaris
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !zos
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!zos
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !aix && !linux && !netbsd
// +build !aix,!linux,!netbsd
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build aix || linux || netbsd
// +build aix linux netbsd
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build aix || darwin || dragonfly || freebsd || netbsd || openbsd
// +build aix darwin dragonfly freebsd netbsd openbsd
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build aix || darwin || dragonfly || freebsd || netbsd
// +build aix darwin dragonfly freebsd netbsd
package socket
-2
View File
@@ -3,8 +3,6 @@
// license that can be found in the LICENSE file.
//go:build (arm || mips || mipsle || 386 || ppc) && linux
// +build arm mips mipsle 386 ppc
// +build linux
package socket
-2
View File
@@ -3,8 +3,6 @@
// license that can be found in the LICENSE file.
//go:build (arm64 || amd64 || loong64 || ppc64 || ppc64le || mips64 || mips64le || riscv64 || s390x) && linux
// +build arm64 amd64 loong64 ppc64 ppc64le mips64 mips64le riscv64 s390x
// +build linux
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build amd64 && solaris
// +build amd64,solaris
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !zos
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!zos
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build s390x && zos
// +build s390x,zos
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !race
// +build !race
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build race
// +build race
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build linux
// +build linux
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || windows || zos
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris windows zos
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !linux
// +build !linux
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !windows && !zos
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!windows,!zos
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build aix || darwin || dragonfly || freebsd || openbsd || solaris
// +build aix darwin dragonfly freebsd openbsd solaris
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build linux && !s390x && !386
// +build linux,!s390x,!386
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build loong64
// +build loong64
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build riscv64
// +build riscv64
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || windows || zos
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris windows zos
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !windows && !zos
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!windows,!zos
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris
package socket
-1
View File
@@ -3,7 +3,6 @@
// Added for go1.11 compatibility
//go:build aix
// +build aix
package socket
-1
View File
@@ -2,7 +2,6 @@
// cgo -godefs defs_linux.go
//go:build loong64
// +build loong64
package socket
-1
View File
@@ -2,7 +2,6 @@
// cgo -godefs defs_linux.go
//go:build riscv64
// +build riscv64
package socket
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build aix || darwin || dragonfly || freebsd || netbsd || openbsd
// +build aix darwin dragonfly freebsd netbsd openbsd
package ipv4
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build darwin || linux || solaris
// +build darwin linux solaris
package ipv4
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !windows && !zos
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!windows,!zos
package ipv4
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris
package ipv4
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !linux
// +build !linux
package ipv4
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
package ipv4
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !zos
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!zos
package ipv4
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || windows || zos
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris windows zos
package ipv4
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !windows && !zos
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!windows,!zos
package ipv4
-1
View File
@@ -4,7 +4,6 @@
// Added for go1.11 compatibility
//go:build aix
// +build aix
package ipv4
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build aix || darwin || dragonfly || freebsd || netbsd || openbsd || solaris || windows
// +build aix darwin dragonfly freebsd netbsd openbsd solaris windows
package ipv4
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !aix && !darwin && !dragonfly && !freebsd && !netbsd && !openbsd && !solaris && !windows
// +build !aix,!darwin,!dragonfly,!freebsd,!netbsd,!openbsd,!solaris,!windows
package ipv4
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build darwin || freebsd || linux
// +build darwin freebsd linux
package ipv4
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !darwin && !freebsd && !linux
// +build !darwin,!freebsd,!linux
package ipv4
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build linux
// +build linux
package ipv4
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !linux
// +build !linux
package ipv4
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build netbsd || openbsd
// +build netbsd openbsd
package ipv4
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build darwin || freebsd || linux || solaris
// +build darwin freebsd linux solaris
package ipv4
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !darwin && !freebsd && !linux && !solaris
// +build !darwin,!freebsd,!linux,!solaris
package ipv4
-1
View File
@@ -3,7 +3,6 @@
// license that can be found in the LICENSE file.
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !windows && !zos
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!windows,!zos
package ipv4

Some files were not shown because too many files have changed in this diff Show More