mirror of
https://github.com/xtaci/kcptun.git
synced 2024-04-21 12:32:32 +00:00
Compare commits
| Author | SHA1 | Date | |
|---|---|---|---|
|
|
15e358a5e8 | ||
|
|
a9225382a8 | ||
|
|
8929bb029d | ||
|
|
13f48e04df | ||
|
|
fa0d5e0765 | ||
|
|
86443d924d | ||
|
|
0440abbc91 | ||
|
|
143991124c |
@@ -29,6 +29,8 @@
|
||||
| Memory | >20MB | >32MB |
|
||||
| CPU | ANY | amd64 with AES-NI & AVX2 |
|
||||
|
||||
*NOTE: if you are using kvm, make sure the guest os can do AES instructions*
|
||||
<img src="https://github.com/xtaci/kcptun/assets/2346725/9358e8e5-2a4a-4be9-9859-62f1aaa553b0" alt="cpuinfo" height="400px"/>
|
||||
|
||||
### QuickStart
|
||||
|
||||
|
||||
Binary file not shown.
@@ -4,24 +4,24 @@ require (
|
||||
github.com/golang/snappy v0.0.4
|
||||
github.com/pkg/errors v0.9.1
|
||||
github.com/urfave/cli v1.22.14
|
||||
github.com/xtaci/kcp-go/v5 v5.6.3
|
||||
github.com/xtaci/kcp-go/v5 v5.6.8
|
||||
github.com/xtaci/smux v1.5.24
|
||||
github.com/xtaci/tcpraw v1.2.25
|
||||
golang.org/x/crypto v0.12.0
|
||||
golang.org/x/crypto v0.17.0
|
||||
)
|
||||
|
||||
require (
|
||||
github.com/coreos/go-iptables v0.7.0 // indirect
|
||||
github.com/cpuguy83/go-md2man/v2 v2.0.2 // indirect
|
||||
github.com/google/gopacket v1.1.19 // indirect
|
||||
github.com/klauspost/cpuid/v2 v2.2.5 // indirect
|
||||
github.com/klauspost/reedsolomon v1.11.8 // indirect
|
||||
github.com/klauspost/cpuid/v2 v2.2.6 // indirect
|
||||
github.com/klauspost/reedsolomon v1.12.0 // indirect
|
||||
github.com/russross/blackfriday/v2 v2.1.0 // indirect
|
||||
github.com/templexxx/cpu v0.1.0 // indirect
|
||||
github.com/templexxx/xorsimd v0.4.2 // indirect
|
||||
github.com/tjfoc/gmsm v1.4.1 // indirect
|
||||
golang.org/x/net v0.14.0 // indirect
|
||||
golang.org/x/sys v0.11.0 // indirect
|
||||
golang.org/x/net v0.19.0 // indirect
|
||||
golang.org/x/sys v0.16.0 // indirect
|
||||
)
|
||||
|
||||
go 1.21
|
||||
|
||||
@@ -33,10 +33,10 @@ github.com/google/go-cmp v0.3.1/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMyw
|
||||
github.com/google/go-cmp v0.4.0/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE=
|
||||
github.com/google/gopacket v1.1.19 h1:ves8RnFZPGiFnTS0uPQStjwru6uO6h+nlr9j6fL7kF8=
|
||||
github.com/google/gopacket v1.1.19/go.mod h1:iJ8V8n6KS+z2U1A8pUwu8bW5SyEMkXJB8Yo/Vo+TKTo=
|
||||
github.com/klauspost/cpuid/v2 v2.2.5 h1:0E5MSMDEoAulmXNFquVs//DdoomxaoTY1kUhbc/qbZg=
|
||||
github.com/klauspost/cpuid/v2 v2.2.5/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws=
|
||||
github.com/klauspost/reedsolomon v1.11.8 h1:s8RpUW5TK4hjr+djiOpbZJB4ksx+TdYbRH7vHQpwPOY=
|
||||
github.com/klauspost/reedsolomon v1.11.8/go.mod h1:4bXRN+cVzMdml6ti7qLouuYi32KHJ5MGv0Qd8a47h6A=
|
||||
github.com/klauspost/cpuid/v2 v2.2.6 h1:ndNyv040zDGIDh8thGkXYjnFtiN02M1PVVF+JE/48xc=
|
||||
github.com/klauspost/cpuid/v2 v2.2.6/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws=
|
||||
github.com/klauspost/reedsolomon v1.12.0 h1:I5FEp3xSwVCcEh3F5A7dofEfhXdF/bWhQWPH+XwBFno=
|
||||
github.com/klauspost/reedsolomon v1.12.0/go.mod h1:EPLZJeh4l27pUGC3aXOjheaoh1I9yut7xTURiW3LQ9Y=
|
||||
github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4=
|
||||
github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0=
|
||||
github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
|
||||
@@ -59,8 +59,12 @@ github.com/tjfoc/gmsm v1.4.1 h1:aMe1GlZb+0bLjn+cKTPEvvn9oUEBlJitaZiiBwsbgho=
|
||||
github.com/tjfoc/gmsm v1.4.1/go.mod h1:j4INPkHWMrhJb38G+J6W4Tw0AbuN8Thu3PbdVYhVcTE=
|
||||
github.com/urfave/cli v1.22.14 h1:ebbhrRiGK2i4naQJr+1Xj92HXZCrK7MsyTS/ob3HnAk=
|
||||
github.com/urfave/cli v1.22.14/go.mod h1:X0eDS6pD6Exaclxm99NJ3FiCDRED7vIHpx2mDOHLvkA=
|
||||
github.com/xtaci/kcp-go/v5 v5.6.3 h1:yd59SKXdJ0PBxeMBy3apalxFCEmBLGgQmL6nP46tU0g=
|
||||
github.com/xtaci/kcp-go/v5 v5.6.3/go.mod h1:uIuw2KEg3FcmEdS4PeXHaGty9Ui7NYb1WKIrSDwpMg4=
|
||||
github.com/xtaci/kcp-go/v5 v5.6.6 h1:SxSjZoaaLzQKxbIfzE1FYLMKtR2veox5mvKO7AliZ5I=
|
||||
github.com/xtaci/kcp-go/v5 v5.6.6/go.mod h1:oE9j2NVqAkuKO5o8ByKGch3vgVX3BNf8zqP8JiGq0bM=
|
||||
github.com/xtaci/kcp-go/v5 v5.6.7 h1:7+rnxNFIsjEwTXQk4cSZpXM4pO0hqtpwE1UFFoJBffA=
|
||||
github.com/xtaci/kcp-go/v5 v5.6.7/go.mod h1:oE9j2NVqAkuKO5o8ByKGch3vgVX3BNf8zqP8JiGq0bM=
|
||||
github.com/xtaci/kcp-go/v5 v5.6.8 h1:jlI/0jAyjoOjT/SaGB58s4bQMJiNS41A2RKzR6TMWeI=
|
||||
github.com/xtaci/kcp-go/v5 v5.6.8/go.mod h1:oE9j2NVqAkuKO5o8ByKGch3vgVX3BNf8zqP8JiGq0bM=
|
||||
github.com/xtaci/lossyconn v0.0.0-20190602105132-8df528c0c9ae h1:J0GxkO96kL4WF+AIT3M4mfUVinOCPgf2uUWYFUzN0sM=
|
||||
github.com/xtaci/lossyconn v0.0.0-20190602105132-8df528c0c9ae/go.mod h1:gXtu8J62kEgmN++bm9BVICuT/e8yiLI2KFobd/TRFsE=
|
||||
github.com/xtaci/smux v1.5.24 h1:77emW9dtnOxxOQ5ltR+8BbsX1kzcOxQ5gB+aaV9hXOY=
|
||||
@@ -71,8 +75,8 @@ golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACk
|
||||
golang.org/x/crypto v0.0.0-20191011191535-87dc89f01550/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI=
|
||||
golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto=
|
||||
golang.org/x/crypto v0.0.0-20201012173705-84dcc777aaee/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto=
|
||||
golang.org/x/crypto v0.12.0 h1:tFM/ta59kqch6LlvYnPa0yx5a83cL2nHflFhYKvv9Yk=
|
||||
golang.org/x/crypto v0.12.0/go.mod h1:NF0Gs7EO5K4qLn+Ylc+fih8BSTeIjAP05siRnAh98yw=
|
||||
golang.org/x/crypto v0.17.0 h1:r8bRNjWL3GshPW3gkd+RpvzWrZAwPS49OmTGZ/uhM4k=
|
||||
golang.org/x/crypto v0.17.0/go.mod h1:gCAAfMLgwOJRpTjQ2zCCt2OcSfYMTeZVSRtQlPC7Nq4=
|
||||
golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA=
|
||||
golang.org/x/lint v0.0.0-20181026193005-c67002cb31c3/go.mod h1:UVdnD1Gm6xHRNCYTkRU2/jEulfH38KcIWyp/GAMgvoE=
|
||||
golang.org/x/lint v0.0.0-20190227174305-5b3e6a55c961/go.mod h1:wehouNa3lNwaWXcvxsM5YxQ5yQlVC4a0KAMCusXpPoU=
|
||||
@@ -86,8 +90,8 @@ golang.org/x/net v0.0.0-20190311183353-d8887717615a/go.mod h1:t9HGtf8HONx5eT2rtn
|
||||
golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg=
|
||||
golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
|
||||
golang.org/x/net v0.0.0-20201010224723-4f7140c49acb/go.mod h1:sp8m0HH+o8qH0wwXwYZr8TS3Oi6o0r6Gce1SSxlDquU=
|
||||
golang.org/x/net v0.14.0 h1:BONx9s002vGdD9umnlX1Po8vOZmrgH34qlHcD1MfK14=
|
||||
golang.org/x/net v0.14.0/go.mod h1:PpSgVXXLK0OxS0F31C1/tv6XNguvCrnXIDrFMspZIUI=
|
||||
golang.org/x/net v0.19.0 h1:zTwKpTd2XuCqf8huc7Fo2iSy+4RHPd10s4KzeTnVr1c=
|
||||
golang.org/x/net v0.19.0/go.mod h1:CfAk/cbD4CthTvqiEl8NpboMuiuOYsAr/7NOjZJtv1U=
|
||||
golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U=
|
||||
golang.org/x/sync v0.0.0-20180314180146-1d60e4601c6f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
|
||||
golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
|
||||
@@ -97,8 +101,8 @@ golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5h
|
||||
golang.org/x/sys v0.0.0-20190412213103-97732733099d/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
|
||||
golang.org/x/sys v0.0.0-20200930185726-fdedc70b468f/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
|
||||
golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
|
||||
golang.org/x/sys v0.11.0 h1:eG7RXZHdqOJ1i+0lgLgCpSXAp6M3LYlAo6osgSi0xOM=
|
||||
golang.org/x/sys v0.11.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
|
||||
golang.org/x/sys v0.16.0 h1:xWw16ngr6ZMtmxDyKyIgsE93KNKz5HKmMa3b8ALHidU=
|
||||
golang.org/x/sys v0.16.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
|
||||
golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
|
||||
golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
|
||||
golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
|
||||
|
||||
+9
-5
@@ -9,10 +9,7 @@ You can access the CPU information by accessing the shared CPU variable of the c
|
||||
Package home: https://github.com/klauspost/cpuid
|
||||
|
||||
[](https://pkg.go.dev/github.com/klauspost/cpuid/v2)
|
||||
[![Build Status][3]][4]
|
||||
|
||||
[3]: https://travis-ci.org/klauspost/cpuid.svg?branch=master
|
||||
[4]: https://travis-ci.org/klauspost/cpuid
|
||||
[](https://github.com/klauspost/cpuid/actions/workflows/go.yml)
|
||||
|
||||
## installing
|
||||
|
||||
@@ -285,7 +282,12 @@ Exit Code 1
|
||||
| AMXINT8 | Tile computational operations on 8-bit integers |
|
||||
| AMXFP16 | Tile computational operations on FP16 numbers |
|
||||
| AMXTILE | Tile architecture |
|
||||
| APX_F | Intel APX |
|
||||
| AVX | AVX functions |
|
||||
| AVX10 | If set the Intel AVX10 Converged Vector ISA is supported |
|
||||
| AVX10_128 | If set indicates that AVX10 128-bit vector support is present |
|
||||
| AVX10_256 | If set indicates that AVX10 256-bit vector support is present |
|
||||
| AVX10_512 | If set indicates that AVX10 512-bit vector support is present |
|
||||
| AVX2 | AVX2 functions |
|
||||
| AVX512BF16 | AVX-512 BFLOAT16 Instructions |
|
||||
| AVX512BITALG | AVX-512 Bit Algorithms |
|
||||
@@ -365,6 +367,8 @@ Exit Code 1
|
||||
| IDPRED_CTRL | IPRED_DIS |
|
||||
| INT_WBINVD | WBINVD/WBNOINVD are interruptible. |
|
||||
| INVLPGB | NVLPGB and TLBSYNC instruction supported |
|
||||
| KEYLOCKER | Key locker |
|
||||
| KEYLOCKERW | Key locker wide |
|
||||
| LAHF | LAHF/SAHF in long mode |
|
||||
| LAM | If set, CPU supports Linear Address Masking |
|
||||
| LBRVIRT | LBR virtualization |
|
||||
@@ -380,7 +384,7 @@ Exit Code 1
|
||||
| MOVDIRI | Move Doubleword as Direct Store |
|
||||
| MOVSB_ZL | Fast Zero-Length MOVSB |
|
||||
| MPX | Intel MPX (Memory Protection Extensions) |
|
||||
| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD |
|
||||
| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD |
|
||||
| MSRIRC | Instruction Retired Counter MSR available |
|
||||
| MSRLIST | Read/Write List of Model Specific Registers |
|
||||
| MSR_PAGEFLUSH | Page Flush MSR available |
|
||||
|
||||
+49
-3
@@ -76,7 +76,12 @@ const (
|
||||
AMXFP16 // Tile computational operations on FP16 numbers
|
||||
AMXINT8 // Tile computational operations on 8-bit integers
|
||||
AMXTILE // Tile architecture
|
||||
APX_F // Intel APX
|
||||
AVX // AVX functions
|
||||
AVX10 // If set the Intel AVX10 Converged Vector ISA is supported
|
||||
AVX10_128 // If set indicates that AVX10 128-bit vector support is present
|
||||
AVX10_256 // If set indicates that AVX10 256-bit vector support is present
|
||||
AVX10_512 // If set indicates that AVX10 512-bit vector support is present
|
||||
AVX2 // AVX2 functions
|
||||
AVX512BF16 // AVX-512 BFLOAT16 Instructions
|
||||
AVX512BITALG // AVX-512 Bit Algorithms
|
||||
@@ -156,6 +161,8 @@ const (
|
||||
IDPRED_CTRL // IPRED_DIS
|
||||
INT_WBINVD // WBINVD/WBNOINVD are interruptible.
|
||||
INVLPGB // NVLPGB and TLBSYNC instruction supported
|
||||
KEYLOCKER // Key locker
|
||||
KEYLOCKERW // Key locker wide
|
||||
LAHF // LAHF/SAHF in long mode
|
||||
LAM // If set, CPU supports Linear Address Masking
|
||||
LBRVIRT // LBR virtualization
|
||||
@@ -302,9 +309,10 @@ type CPUInfo struct {
|
||||
L2 int // L2 Cache (per core or shared). Will be -1 if undetected
|
||||
L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected
|
||||
}
|
||||
SGX SGXSupport
|
||||
maxFunc uint32
|
||||
maxExFunc uint32
|
||||
SGX SGXSupport
|
||||
AVX10Level uint8
|
||||
maxFunc uint32
|
||||
maxExFunc uint32
|
||||
}
|
||||
|
||||
var cpuid func(op uint32) (eax, ebx, ecx, edx uint32)
|
||||
@@ -1165,6 +1173,7 @@ func support() flagSet {
|
||||
fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ)
|
||||
fs.setIf(ecx&(1<<13) != 0, TME)
|
||||
fs.setIf(ecx&(1<<25) != 0, CLDEMOTE)
|
||||
fs.setIf(ecx&(1<<23) != 0, KEYLOCKER)
|
||||
fs.setIf(ecx&(1<<27) != 0, MOVDIRI)
|
||||
fs.setIf(ecx&(1<<28) != 0, MOVDIR64B)
|
||||
fs.setIf(ecx&(1<<29) != 0, ENQCMD)
|
||||
@@ -1202,6 +1211,8 @@ func support() flagSet {
|
||||
fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
|
||||
fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
|
||||
fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
|
||||
fs.setIf(edx1&(1<<19) != 0, AVX10)
|
||||
fs.setIf(edx1&(1<<21) != 0, APX_F)
|
||||
|
||||
// Only detect AVX-512 features if XGETBV is supported
|
||||
if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) {
|
||||
@@ -1252,6 +1263,19 @@ func support() flagSet {
|
||||
fs.setIf(edx&(1<<4) != 0, BHI_CTRL)
|
||||
fs.setIf(edx&(1<<5) != 0, MCDT_NO)
|
||||
|
||||
// Add keylocker features.
|
||||
if fs.inSet(KEYLOCKER) && mfi >= 0x19 {
|
||||
_, ebx, _, _ := cpuidex(0x19, 0)
|
||||
fs.setIf(ebx&5 == 5, KEYLOCKERW) // Bit 0 and 2 (1+4)
|
||||
}
|
||||
|
||||
// Add AVX10 features.
|
||||
if fs.inSet(AVX10) && mfi >= 0x24 {
|
||||
_, ebx, _, _ := cpuidex(0x24, 0)
|
||||
fs.setIf(ebx&(1<<16) != 0, AVX10_128)
|
||||
fs.setIf(ebx&(1<<17) != 0, AVX10_256)
|
||||
fs.setIf(ebx&(1<<18) != 0, AVX10_512)
|
||||
}
|
||||
}
|
||||
|
||||
// Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1)
|
||||
@@ -1394,6 +1418,20 @@ func support() flagSet {
|
||||
fs.setIf((a>>24)&1 == 1, VMSA_REGPROT)
|
||||
}
|
||||
|
||||
if mfi >= 0x20 {
|
||||
// Microsoft has decided to purposefully hide the information
|
||||
// of the guest TEE when VMs are being created using Hyper-V.
|
||||
//
|
||||
// This leads us to check for the Hyper-V cpuid features
|
||||
// (0x4000000C), and then for the `ebx` value set.
|
||||
//
|
||||
// For Intel TDX, `ebx` is set as `0xbe3`, being 3 the part
|
||||
// we're mostly interested about,according to:
|
||||
// https://github.com/torvalds/linux/blob/d2f51b3516dade79269ff45eae2a7668ae711b25/arch/x86/include/asm/hyperv-tlfs.h#L169-L174
|
||||
_, ebx, _, _ := cpuid(0x4000000C)
|
||||
fs.setIf(ebx == 0xbe3, TDX_GUEST)
|
||||
}
|
||||
|
||||
if mfi >= 0x21 {
|
||||
// Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21).
|
||||
_, ebx, ecx, edx := cpuid(0x21)
|
||||
@@ -1404,6 +1442,14 @@ func support() flagSet {
|
||||
return fs
|
||||
}
|
||||
|
||||
func (c *CPUInfo) supportAVX10() uint8 {
|
||||
if c.maxFunc >= 0x24 && c.featureSet.inSet(AVX10) {
|
||||
_, ebx, _, _ := cpuidex(0x24, 0)
|
||||
return uint8(ebx)
|
||||
}
|
||||
return 0
|
||||
}
|
||||
|
||||
func valAsString(values ...uint32) []byte {
|
||||
r := make([]byte, 4*len(values))
|
||||
for i, v := range values {
|
||||
|
||||
+1
@@ -31,6 +31,7 @@ func addInfo(c *CPUInfo, safe bool) {
|
||||
c.LogicalCores = logicalCores()
|
||||
c.PhysicalCores = physicalCores()
|
||||
c.VendorID, c.VendorString = vendorID()
|
||||
c.AVX10Level = c.supportAVX10()
|
||||
c.cacheSize()
|
||||
c.frequencies()
|
||||
}
|
||||
|
||||
+207
-200
@@ -16,210 +16,217 @@ func _() {
|
||||
_ = x[AMXFP16-6]
|
||||
_ = x[AMXINT8-7]
|
||||
_ = x[AMXTILE-8]
|
||||
_ = x[AVX-9]
|
||||
_ = x[AVX2-10]
|
||||
_ = x[AVX512BF16-11]
|
||||
_ = x[AVX512BITALG-12]
|
||||
_ = x[AVX512BW-13]
|
||||
_ = x[AVX512CD-14]
|
||||
_ = x[AVX512DQ-15]
|
||||
_ = x[AVX512ER-16]
|
||||
_ = x[AVX512F-17]
|
||||
_ = x[AVX512FP16-18]
|
||||
_ = x[AVX512IFMA-19]
|
||||
_ = x[AVX512PF-20]
|
||||
_ = x[AVX512VBMI-21]
|
||||
_ = x[AVX512VBMI2-22]
|
||||
_ = x[AVX512VL-23]
|
||||
_ = x[AVX512VNNI-24]
|
||||
_ = x[AVX512VP2INTERSECT-25]
|
||||
_ = x[AVX512VPOPCNTDQ-26]
|
||||
_ = x[AVXIFMA-27]
|
||||
_ = x[AVXNECONVERT-28]
|
||||
_ = x[AVXSLOW-29]
|
||||
_ = x[AVXVNNI-30]
|
||||
_ = x[AVXVNNIINT8-31]
|
||||
_ = x[BHI_CTRL-32]
|
||||
_ = x[BMI1-33]
|
||||
_ = x[BMI2-34]
|
||||
_ = x[CETIBT-35]
|
||||
_ = x[CETSS-36]
|
||||
_ = x[CLDEMOTE-37]
|
||||
_ = x[CLMUL-38]
|
||||
_ = x[CLZERO-39]
|
||||
_ = x[CMOV-40]
|
||||
_ = x[CMPCCXADD-41]
|
||||
_ = x[CMPSB_SCADBS_SHORT-42]
|
||||
_ = x[CMPXCHG8-43]
|
||||
_ = x[CPBOOST-44]
|
||||
_ = x[CPPC-45]
|
||||
_ = x[CX16-46]
|
||||
_ = x[EFER_LMSLE_UNS-47]
|
||||
_ = x[ENQCMD-48]
|
||||
_ = x[ERMS-49]
|
||||
_ = x[F16C-50]
|
||||
_ = x[FLUSH_L1D-51]
|
||||
_ = x[FMA3-52]
|
||||
_ = x[FMA4-53]
|
||||
_ = x[FP128-54]
|
||||
_ = x[FP256-55]
|
||||
_ = x[FSRM-56]
|
||||
_ = x[FXSR-57]
|
||||
_ = x[FXSROPT-58]
|
||||
_ = x[GFNI-59]
|
||||
_ = x[HLE-60]
|
||||
_ = x[HRESET-61]
|
||||
_ = x[HTT-62]
|
||||
_ = x[HWA-63]
|
||||
_ = x[HYBRID_CPU-64]
|
||||
_ = x[HYPERVISOR-65]
|
||||
_ = x[IA32_ARCH_CAP-66]
|
||||
_ = x[IA32_CORE_CAP-67]
|
||||
_ = x[IBPB-68]
|
||||
_ = x[IBRS-69]
|
||||
_ = x[IBRS_PREFERRED-70]
|
||||
_ = x[IBRS_PROVIDES_SMP-71]
|
||||
_ = x[IBS-72]
|
||||
_ = x[IBSBRNTRGT-73]
|
||||
_ = x[IBSFETCHSAM-74]
|
||||
_ = x[IBSFFV-75]
|
||||
_ = x[IBSOPCNT-76]
|
||||
_ = x[IBSOPCNTEXT-77]
|
||||
_ = x[IBSOPSAM-78]
|
||||
_ = x[IBSRDWROPCNT-79]
|
||||
_ = x[IBSRIPINVALIDCHK-80]
|
||||
_ = x[IBS_FETCH_CTLX-81]
|
||||
_ = x[IBS_OPDATA4-82]
|
||||
_ = x[IBS_OPFUSE-83]
|
||||
_ = x[IBS_PREVENTHOST-84]
|
||||
_ = x[IBS_ZEN4-85]
|
||||
_ = x[IDPRED_CTRL-86]
|
||||
_ = x[INT_WBINVD-87]
|
||||
_ = x[INVLPGB-88]
|
||||
_ = x[LAHF-89]
|
||||
_ = x[LAM-90]
|
||||
_ = x[LBRVIRT-91]
|
||||
_ = x[LZCNT-92]
|
||||
_ = x[MCAOVERFLOW-93]
|
||||
_ = x[MCDT_NO-94]
|
||||
_ = x[MCOMMIT-95]
|
||||
_ = x[MD_CLEAR-96]
|
||||
_ = x[MMX-97]
|
||||
_ = x[MMXEXT-98]
|
||||
_ = x[MOVBE-99]
|
||||
_ = x[MOVDIR64B-100]
|
||||
_ = x[MOVDIRI-101]
|
||||
_ = x[MOVSB_ZL-102]
|
||||
_ = x[MOVU-103]
|
||||
_ = x[MPX-104]
|
||||
_ = x[MSRIRC-105]
|
||||
_ = x[MSRLIST-106]
|
||||
_ = x[MSR_PAGEFLUSH-107]
|
||||
_ = x[NRIPS-108]
|
||||
_ = x[NX-109]
|
||||
_ = x[OSXSAVE-110]
|
||||
_ = x[PCONFIG-111]
|
||||
_ = x[POPCNT-112]
|
||||
_ = x[PPIN-113]
|
||||
_ = x[PREFETCHI-114]
|
||||
_ = x[PSFD-115]
|
||||
_ = x[RDPRU-116]
|
||||
_ = x[RDRAND-117]
|
||||
_ = x[RDSEED-118]
|
||||
_ = x[RDTSCP-119]
|
||||
_ = x[RRSBA_CTRL-120]
|
||||
_ = x[RTM-121]
|
||||
_ = x[RTM_ALWAYS_ABORT-122]
|
||||
_ = x[SERIALIZE-123]
|
||||
_ = x[SEV-124]
|
||||
_ = x[SEV_64BIT-125]
|
||||
_ = x[SEV_ALTERNATIVE-126]
|
||||
_ = x[SEV_DEBUGSWAP-127]
|
||||
_ = x[SEV_ES-128]
|
||||
_ = x[SEV_RESTRICTED-129]
|
||||
_ = x[SEV_SNP-130]
|
||||
_ = x[SGX-131]
|
||||
_ = x[SGXLC-132]
|
||||
_ = x[SHA-133]
|
||||
_ = x[SME-134]
|
||||
_ = x[SME_COHERENT-135]
|
||||
_ = x[SPEC_CTRL_SSBD-136]
|
||||
_ = x[SRBDS_CTRL-137]
|
||||
_ = x[SSE-138]
|
||||
_ = x[SSE2-139]
|
||||
_ = x[SSE3-140]
|
||||
_ = x[SSE4-141]
|
||||
_ = x[SSE42-142]
|
||||
_ = x[SSE4A-143]
|
||||
_ = x[SSSE3-144]
|
||||
_ = x[STIBP-145]
|
||||
_ = x[STIBP_ALWAYSON-146]
|
||||
_ = x[STOSB_SHORT-147]
|
||||
_ = x[SUCCOR-148]
|
||||
_ = x[SVM-149]
|
||||
_ = x[SVMDA-150]
|
||||
_ = x[SVMFBASID-151]
|
||||
_ = x[SVML-152]
|
||||
_ = x[SVMNP-153]
|
||||
_ = x[SVMPF-154]
|
||||
_ = x[SVMPFT-155]
|
||||
_ = x[SYSCALL-156]
|
||||
_ = x[SYSEE-157]
|
||||
_ = x[TBM-158]
|
||||
_ = x[TDX_GUEST-159]
|
||||
_ = x[TLB_FLUSH_NESTED-160]
|
||||
_ = x[TME-161]
|
||||
_ = x[TOPEXT-162]
|
||||
_ = x[TSCRATEMSR-163]
|
||||
_ = x[TSXLDTRK-164]
|
||||
_ = x[VAES-165]
|
||||
_ = x[VMCBCLEAN-166]
|
||||
_ = x[VMPL-167]
|
||||
_ = x[VMSA_REGPROT-168]
|
||||
_ = x[VMX-169]
|
||||
_ = x[VPCLMULQDQ-170]
|
||||
_ = x[VTE-171]
|
||||
_ = x[WAITPKG-172]
|
||||
_ = x[WBNOINVD-173]
|
||||
_ = x[WRMSRNS-174]
|
||||
_ = x[X87-175]
|
||||
_ = x[XGETBV1-176]
|
||||
_ = x[XOP-177]
|
||||
_ = x[XSAVE-178]
|
||||
_ = x[XSAVEC-179]
|
||||
_ = x[XSAVEOPT-180]
|
||||
_ = x[XSAVES-181]
|
||||
_ = x[AESARM-182]
|
||||
_ = x[ARMCPUID-183]
|
||||
_ = x[ASIMD-184]
|
||||
_ = x[ASIMDDP-185]
|
||||
_ = x[ASIMDHP-186]
|
||||
_ = x[ASIMDRDM-187]
|
||||
_ = x[ATOMICS-188]
|
||||
_ = x[CRC32-189]
|
||||
_ = x[DCPOP-190]
|
||||
_ = x[EVTSTRM-191]
|
||||
_ = x[FCMA-192]
|
||||
_ = x[FP-193]
|
||||
_ = x[FPHP-194]
|
||||
_ = x[GPA-195]
|
||||
_ = x[JSCVT-196]
|
||||
_ = x[LRCPC-197]
|
||||
_ = x[PMULL-198]
|
||||
_ = x[SHA1-199]
|
||||
_ = x[SHA2-200]
|
||||
_ = x[SHA3-201]
|
||||
_ = x[SHA512-202]
|
||||
_ = x[SM3-203]
|
||||
_ = x[SM4-204]
|
||||
_ = x[SVE-205]
|
||||
_ = x[lastID-206]
|
||||
_ = x[APX_F-9]
|
||||
_ = x[AVX-10]
|
||||
_ = x[AVX10-11]
|
||||
_ = x[AVX10_128-12]
|
||||
_ = x[AVX10_256-13]
|
||||
_ = x[AVX10_512-14]
|
||||
_ = x[AVX2-15]
|
||||
_ = x[AVX512BF16-16]
|
||||
_ = x[AVX512BITALG-17]
|
||||
_ = x[AVX512BW-18]
|
||||
_ = x[AVX512CD-19]
|
||||
_ = x[AVX512DQ-20]
|
||||
_ = x[AVX512ER-21]
|
||||
_ = x[AVX512F-22]
|
||||
_ = x[AVX512FP16-23]
|
||||
_ = x[AVX512IFMA-24]
|
||||
_ = x[AVX512PF-25]
|
||||
_ = x[AVX512VBMI-26]
|
||||
_ = x[AVX512VBMI2-27]
|
||||
_ = x[AVX512VL-28]
|
||||
_ = x[AVX512VNNI-29]
|
||||
_ = x[AVX512VP2INTERSECT-30]
|
||||
_ = x[AVX512VPOPCNTDQ-31]
|
||||
_ = x[AVXIFMA-32]
|
||||
_ = x[AVXNECONVERT-33]
|
||||
_ = x[AVXSLOW-34]
|
||||
_ = x[AVXVNNI-35]
|
||||
_ = x[AVXVNNIINT8-36]
|
||||
_ = x[BHI_CTRL-37]
|
||||
_ = x[BMI1-38]
|
||||
_ = x[BMI2-39]
|
||||
_ = x[CETIBT-40]
|
||||
_ = x[CETSS-41]
|
||||
_ = x[CLDEMOTE-42]
|
||||
_ = x[CLMUL-43]
|
||||
_ = x[CLZERO-44]
|
||||
_ = x[CMOV-45]
|
||||
_ = x[CMPCCXADD-46]
|
||||
_ = x[CMPSB_SCADBS_SHORT-47]
|
||||
_ = x[CMPXCHG8-48]
|
||||
_ = x[CPBOOST-49]
|
||||
_ = x[CPPC-50]
|
||||
_ = x[CX16-51]
|
||||
_ = x[EFER_LMSLE_UNS-52]
|
||||
_ = x[ENQCMD-53]
|
||||
_ = x[ERMS-54]
|
||||
_ = x[F16C-55]
|
||||
_ = x[FLUSH_L1D-56]
|
||||
_ = x[FMA3-57]
|
||||
_ = x[FMA4-58]
|
||||
_ = x[FP128-59]
|
||||
_ = x[FP256-60]
|
||||
_ = x[FSRM-61]
|
||||
_ = x[FXSR-62]
|
||||
_ = x[FXSROPT-63]
|
||||
_ = x[GFNI-64]
|
||||
_ = x[HLE-65]
|
||||
_ = x[HRESET-66]
|
||||
_ = x[HTT-67]
|
||||
_ = x[HWA-68]
|
||||
_ = x[HYBRID_CPU-69]
|
||||
_ = x[HYPERVISOR-70]
|
||||
_ = x[IA32_ARCH_CAP-71]
|
||||
_ = x[IA32_CORE_CAP-72]
|
||||
_ = x[IBPB-73]
|
||||
_ = x[IBRS-74]
|
||||
_ = x[IBRS_PREFERRED-75]
|
||||
_ = x[IBRS_PROVIDES_SMP-76]
|
||||
_ = x[IBS-77]
|
||||
_ = x[IBSBRNTRGT-78]
|
||||
_ = x[IBSFETCHSAM-79]
|
||||
_ = x[IBSFFV-80]
|
||||
_ = x[IBSOPCNT-81]
|
||||
_ = x[IBSOPCNTEXT-82]
|
||||
_ = x[IBSOPSAM-83]
|
||||
_ = x[IBSRDWROPCNT-84]
|
||||
_ = x[IBSRIPINVALIDCHK-85]
|
||||
_ = x[IBS_FETCH_CTLX-86]
|
||||
_ = x[IBS_OPDATA4-87]
|
||||
_ = x[IBS_OPFUSE-88]
|
||||
_ = x[IBS_PREVENTHOST-89]
|
||||
_ = x[IBS_ZEN4-90]
|
||||
_ = x[IDPRED_CTRL-91]
|
||||
_ = x[INT_WBINVD-92]
|
||||
_ = x[INVLPGB-93]
|
||||
_ = x[KEYLOCKER-94]
|
||||
_ = x[KEYLOCKERW-95]
|
||||
_ = x[LAHF-96]
|
||||
_ = x[LAM-97]
|
||||
_ = x[LBRVIRT-98]
|
||||
_ = x[LZCNT-99]
|
||||
_ = x[MCAOVERFLOW-100]
|
||||
_ = x[MCDT_NO-101]
|
||||
_ = x[MCOMMIT-102]
|
||||
_ = x[MD_CLEAR-103]
|
||||
_ = x[MMX-104]
|
||||
_ = x[MMXEXT-105]
|
||||
_ = x[MOVBE-106]
|
||||
_ = x[MOVDIR64B-107]
|
||||
_ = x[MOVDIRI-108]
|
||||
_ = x[MOVSB_ZL-109]
|
||||
_ = x[MOVU-110]
|
||||
_ = x[MPX-111]
|
||||
_ = x[MSRIRC-112]
|
||||
_ = x[MSRLIST-113]
|
||||
_ = x[MSR_PAGEFLUSH-114]
|
||||
_ = x[NRIPS-115]
|
||||
_ = x[NX-116]
|
||||
_ = x[OSXSAVE-117]
|
||||
_ = x[PCONFIG-118]
|
||||
_ = x[POPCNT-119]
|
||||
_ = x[PPIN-120]
|
||||
_ = x[PREFETCHI-121]
|
||||
_ = x[PSFD-122]
|
||||
_ = x[RDPRU-123]
|
||||
_ = x[RDRAND-124]
|
||||
_ = x[RDSEED-125]
|
||||
_ = x[RDTSCP-126]
|
||||
_ = x[RRSBA_CTRL-127]
|
||||
_ = x[RTM-128]
|
||||
_ = x[RTM_ALWAYS_ABORT-129]
|
||||
_ = x[SERIALIZE-130]
|
||||
_ = x[SEV-131]
|
||||
_ = x[SEV_64BIT-132]
|
||||
_ = x[SEV_ALTERNATIVE-133]
|
||||
_ = x[SEV_DEBUGSWAP-134]
|
||||
_ = x[SEV_ES-135]
|
||||
_ = x[SEV_RESTRICTED-136]
|
||||
_ = x[SEV_SNP-137]
|
||||
_ = x[SGX-138]
|
||||
_ = x[SGXLC-139]
|
||||
_ = x[SHA-140]
|
||||
_ = x[SME-141]
|
||||
_ = x[SME_COHERENT-142]
|
||||
_ = x[SPEC_CTRL_SSBD-143]
|
||||
_ = x[SRBDS_CTRL-144]
|
||||
_ = x[SSE-145]
|
||||
_ = x[SSE2-146]
|
||||
_ = x[SSE3-147]
|
||||
_ = x[SSE4-148]
|
||||
_ = x[SSE42-149]
|
||||
_ = x[SSE4A-150]
|
||||
_ = x[SSSE3-151]
|
||||
_ = x[STIBP-152]
|
||||
_ = x[STIBP_ALWAYSON-153]
|
||||
_ = x[STOSB_SHORT-154]
|
||||
_ = x[SUCCOR-155]
|
||||
_ = x[SVM-156]
|
||||
_ = x[SVMDA-157]
|
||||
_ = x[SVMFBASID-158]
|
||||
_ = x[SVML-159]
|
||||
_ = x[SVMNP-160]
|
||||
_ = x[SVMPF-161]
|
||||
_ = x[SVMPFT-162]
|
||||
_ = x[SYSCALL-163]
|
||||
_ = x[SYSEE-164]
|
||||
_ = x[TBM-165]
|
||||
_ = x[TDX_GUEST-166]
|
||||
_ = x[TLB_FLUSH_NESTED-167]
|
||||
_ = x[TME-168]
|
||||
_ = x[TOPEXT-169]
|
||||
_ = x[TSCRATEMSR-170]
|
||||
_ = x[TSXLDTRK-171]
|
||||
_ = x[VAES-172]
|
||||
_ = x[VMCBCLEAN-173]
|
||||
_ = x[VMPL-174]
|
||||
_ = x[VMSA_REGPROT-175]
|
||||
_ = x[VMX-176]
|
||||
_ = x[VPCLMULQDQ-177]
|
||||
_ = x[VTE-178]
|
||||
_ = x[WAITPKG-179]
|
||||
_ = x[WBNOINVD-180]
|
||||
_ = x[WRMSRNS-181]
|
||||
_ = x[X87-182]
|
||||
_ = x[XGETBV1-183]
|
||||
_ = x[XOP-184]
|
||||
_ = x[XSAVE-185]
|
||||
_ = x[XSAVEC-186]
|
||||
_ = x[XSAVEOPT-187]
|
||||
_ = x[XSAVES-188]
|
||||
_ = x[AESARM-189]
|
||||
_ = x[ARMCPUID-190]
|
||||
_ = x[ASIMD-191]
|
||||
_ = x[ASIMDDP-192]
|
||||
_ = x[ASIMDHP-193]
|
||||
_ = x[ASIMDRDM-194]
|
||||
_ = x[ATOMICS-195]
|
||||
_ = x[CRC32-196]
|
||||
_ = x[DCPOP-197]
|
||||
_ = x[EVTSTRM-198]
|
||||
_ = x[FCMA-199]
|
||||
_ = x[FP-200]
|
||||
_ = x[FPHP-201]
|
||||
_ = x[GPA-202]
|
||||
_ = x[JSCVT-203]
|
||||
_ = x[LRCPC-204]
|
||||
_ = x[PMULL-205]
|
||||
_ = x[SHA1-206]
|
||||
_ = x[SHA2-207]
|
||||
_ = x[SHA3-208]
|
||||
_ = x[SHA512-209]
|
||||
_ = x[SM3-210]
|
||||
_ = x[SM4-211]
|
||||
_ = x[SVE-212]
|
||||
_ = x[lastID-213]
|
||||
_ = x[firstID-0]
|
||||
}
|
||||
|
||||
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
|
||||
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
|
||||
|
||||
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465}
|
||||
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 319, 323, 327, 333, 338, 346, 351, 357, 361, 370, 388, 396, 403, 407, 411, 425, 431, 435, 439, 448, 452, 456, 461, 466, 470, 474, 481, 485, 488, 494, 497, 500, 510, 520, 533, 546, 550, 554, 568, 585, 588, 598, 609, 615, 623, 634, 642, 654, 670, 684, 695, 705, 720, 728, 739, 749, 756, 765, 775, 779, 782, 789, 794, 805, 812, 819, 827, 830, 836, 841, 850, 857, 865, 869, 872, 878, 885, 898, 903, 905, 912, 919, 925, 929, 938, 942, 947, 953, 959, 965, 975, 978, 994, 1003, 1006, 1015, 1030, 1043, 1049, 1063, 1070, 1073, 1078, 1081, 1084, 1096, 1110, 1120, 1123, 1127, 1131, 1135, 1140, 1145, 1150, 1155, 1169, 1180, 1186, 1189, 1194, 1203, 1207, 1212, 1217, 1223, 1230, 1235, 1238, 1247, 1263, 1266, 1272, 1282, 1290, 1294, 1303, 1307, 1319, 1322, 1332, 1335, 1342, 1350, 1357, 1360, 1367, 1370, 1375, 1381, 1389, 1395, 1401, 1409, 1414, 1421, 1428, 1436, 1443, 1448, 1453, 1460, 1464, 1466, 1470, 1473, 1478, 1483, 1488, 1492, 1496, 1500, 1506, 1509, 1512, 1515, 1521}
|
||||
|
||||
func (i FeatureID) String() string {
|
||||
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
|
||||
|
||||
+15
@@ -534,6 +534,21 @@ BenchmarkGaloisXor128K-160 862.02 7905.00 9.17x
|
||||
BenchmarkGaloisXor1M-160 784.60 6296.65 8.03x
|
||||
```
|
||||
|
||||
# Legal
|
||||
|
||||
> None of section below is legal advice. Seek your own legal counsel.
|
||||
> As stated by the [LICENSE](LICENSE) the authors will not be held reliable for any use of this library.
|
||||
> Users are encouraged to independently verify they comply with all legal requirements.
|
||||
|
||||
As can be seen in [recent news](https://www.datanami.com/2023/10/16/cloudera-hit-with-240-million-judgement-over-erasure-coding/)
|
||||
there has been lawsuits related to possible patents of aspects of erasure coding functionality.
|
||||
|
||||
As a possible mitigation it is possible to use the tag `nopshufb` when compiling any code which includes this package.
|
||||
This will remove all inclusion and use of `PSHUFB` and equivalent on other platforms.
|
||||
|
||||
This is done by adding `-tags=nopshufb` to `go build` and similar commands that produce binary output.
|
||||
|
||||
The removed code may not be infringing and even after `-tags=nopshufb` there may still be infringing code left.
|
||||
|
||||
# Links
|
||||
* [Backblaze Open Sources Reed-Solomon Erasure Coding Source Code](https://www.backblaze.com/blog/reed-solomon/).
|
||||
|
||||
+13
-8
@@ -62,21 +62,17 @@ var logTable = [fieldSize]byte{
|
||||
|
||||
/**
|
||||
* Inverse of the logarithm table. Maps integer logarithms
|
||||
* to members of the field. There is no entry for 255
|
||||
* because the highest log is 254.
|
||||
* to members of the field. Entry 255 is the same as entry 0 sue to mod 255.
|
||||
*
|
||||
* This table was generated by `go run gentables.go`
|
||||
* Table has been truncated to 256 bytes, since no lookups are bigger.
|
||||
*/
|
||||
var expTable = []byte{0x1, 0x2, 0x4, 0x8, 0x10, 0x20, 0x40, 0x80, 0x1d, 0x3a, 0x74, 0xe8, 0xcd, 0x87, 0x13, 0x26, 0x4c, 0x98, 0x2d, 0x5a, 0xb4, 0x75, 0xea, 0xc9, 0x8f, 0x3, 0x6, 0xc, 0x18, 0x30, 0x60, 0xc0, 0x9d, 0x27, 0x4e, 0x9c, 0x25, 0x4a, 0x94, 0x35, 0x6a, 0xd4, 0xb5, 0x77, 0xee, 0xc1, 0x9f, 0x23, 0x46, 0x8c, 0x5, 0xa, 0x14, 0x28, 0x50, 0xa0, 0x5d, 0xba, 0x69, 0xd2, 0xb9, 0x6f, 0xde, 0xa1, 0x5f, 0xbe, 0x61, 0xc2, 0x99, 0x2f, 0x5e, 0xbc, 0x65, 0xca, 0x89, 0xf, 0x1e, 0x3c, 0x78, 0xf0, 0xfd, 0xe7, 0xd3, 0xbb, 0x6b, 0xd6, 0xb1, 0x7f, 0xfe, 0xe1, 0xdf, 0xa3, 0x5b, 0xb6, 0x71, 0xe2, 0xd9, 0xaf, 0x43, 0x86, 0x11, 0x22, 0x44, 0x88, 0xd, 0x1a, 0x34, 0x68, 0xd0, 0xbd, 0x67, 0xce, 0x81, 0x1f, 0x3e, 0x7c, 0xf8, 0xed, 0xc7, 0x93, 0x3b, 0x76, 0xec, 0xc5, 0x97, 0x33, 0x66, 0xcc, 0x85, 0x17, 0x2e, 0x5c, 0xb8, 0x6d, 0xda, 0xa9, 0x4f, 0x9e, 0x21, 0x42, 0x84, 0x15, 0x2a, 0x54, 0xa8, 0x4d, 0x9a, 0x29, 0x52, 0xa4, 0x55, 0xaa, 0x49, 0x92, 0x39, 0x72, 0xe4, 0xd5, 0xb7, 0x73, 0xe6, 0xd1, 0xbf, 0x63, 0xc6, 0x91, 0x3f, 0x7e, 0xfc, 0xe5, 0xd7, 0xb3, 0x7b, 0xf6, 0xf1, 0xff, 0xe3, 0xdb, 0xab, 0x4b, 0x96, 0x31, 0x62, 0xc4, 0x95, 0x37, 0x6e, 0xdc, 0xa5, 0x57, 0xae, 0x41, 0x82, 0x19, 0x32, 0x64, 0xc8, 0x8d, 0x7, 0xe, 0x1c, 0x38, 0x70, 0xe0, 0xdd, 0xa7, 0x53, 0xa6, 0x51, 0xa2, 0x59, 0xb2, 0x79, 0xf2, 0xf9, 0xef, 0xc3, 0x9b, 0x2b, 0x56, 0xac, 0x45, 0x8a, 0x9, 0x12, 0x24, 0x48, 0x90, 0x3d, 0x7a, 0xf4, 0xf5, 0xf7, 0xf3, 0xfb, 0xeb, 0xcb, 0x8b, 0xb, 0x16, 0x2c, 0x58, 0xb0, 0x7d, 0xfa, 0xe9, 0xcf, 0x83, 0x1b, 0x36, 0x6c, 0xd8, 0xad, 0x47, 0x8e, 0x1, 0x2, 0x4, 0x8, 0x10, 0x20, 0x40, 0x80, 0x1d, 0x3a, 0x74, 0xe8, 0xcd, 0x87, 0x13, 0x26, 0x4c, 0x98, 0x2d, 0x5a, 0xb4, 0x75, 0xea, 0xc9, 0x8f, 0x3, 0x6, 0xc, 0x18, 0x30, 0x60, 0xc0, 0x9d, 0x27, 0x4e, 0x9c, 0x25, 0x4a, 0x94, 0x35, 0x6a, 0xd4, 0xb5, 0x77, 0xee, 0xc1, 0x9f, 0x23, 0x46, 0x8c, 0x5, 0xa, 0x14, 0x28, 0x50, 0xa0, 0x5d, 0xba, 0x69, 0xd2, 0xb9, 0x6f, 0xde, 0xa1, 0x5f, 0xbe, 0x61, 0xc2, 0x99, 0x2f, 0x5e, 0xbc, 0x65, 0xca, 0x89, 0xf, 0x1e, 0x3c, 0x78, 0xf0, 0xfd, 0xe7, 0xd3, 0xbb, 0x6b, 0xd6, 0xb1, 0x7f, 0xfe, 0xe1, 0xdf, 0xa3, 0x5b, 0xb6, 0x71, 0xe2, 0xd9, 0xaf, 0x43, 0x86, 0x11, 0x22, 0x44, 0x88, 0xd, 0x1a, 0x34, 0x68, 0xd0, 0xbd, 0x67, 0xce, 0x81, 0x1f, 0x3e, 0x7c, 0xf8, 0xed, 0xc7, 0x93, 0x3b, 0x76, 0xec, 0xc5, 0x97, 0x33, 0x66, 0xcc, 0x85, 0x17, 0x2e, 0x5c, 0xb8, 0x6d, 0xda, 0xa9, 0x4f, 0x9e, 0x21, 0x42, 0x84, 0x15, 0x2a, 0x54, 0xa8, 0x4d, 0x9a, 0x29, 0x52, 0xa4, 0x55, 0xaa, 0x49, 0x92, 0x39, 0x72, 0xe4, 0xd5, 0xb7, 0x73, 0xe6, 0xd1, 0xbf, 0x63, 0xc6, 0x91, 0x3f, 0x7e, 0xfc, 0xe5, 0xd7, 0xb3, 0x7b, 0xf6, 0xf1, 0xff, 0xe3, 0xdb, 0xab, 0x4b, 0x96, 0x31, 0x62, 0xc4, 0x95, 0x37, 0x6e, 0xdc, 0xa5, 0x57, 0xae, 0x41, 0x82, 0x19, 0x32, 0x64, 0xc8, 0x8d, 0x7, 0xe, 0x1c, 0x38, 0x70, 0xe0, 0xdd, 0xa7, 0x53, 0xa6, 0x51, 0xa2, 0x59, 0xb2, 0x79, 0xf2, 0xf9, 0xef, 0xc3, 0x9b, 0x2b, 0x56, 0xac, 0x45, 0x8a, 0x9, 0x12, 0x24, 0x48, 0x90, 0x3d, 0x7a, 0xf4, 0xf5, 0xf7, 0xf3, 0xfb, 0xeb, 0xcb, 0x8b, 0xb, 0x16, 0x2c, 0x58, 0xb0, 0x7d, 0xfa, 0xe9, 0xcf, 0x83, 0x1b, 0x36, 0x6c, 0xd8, 0xad, 0x47, 0x8e}
|
||||
var expTable = [256]byte{0x1, 0x2, 0x4, 0x8, 0x10, 0x20, 0x40, 0x80, 0x1d, 0x3a, 0x74, 0xe8, 0xcd, 0x87, 0x13, 0x26, 0x4c, 0x98, 0x2d, 0x5a, 0xb4, 0x75, 0xea, 0xc9, 0x8f, 0x3, 0x6, 0xc, 0x18, 0x30, 0x60, 0xc0, 0x9d, 0x27, 0x4e, 0x9c, 0x25, 0x4a, 0x94, 0x35, 0x6a, 0xd4, 0xb5, 0x77, 0xee, 0xc1, 0x9f, 0x23, 0x46, 0x8c, 0x5, 0xa, 0x14, 0x28, 0x50, 0xa0, 0x5d, 0xba, 0x69, 0xd2, 0xb9, 0x6f, 0xde, 0xa1, 0x5f, 0xbe, 0x61, 0xc2, 0x99, 0x2f, 0x5e, 0xbc, 0x65, 0xca, 0x89, 0xf, 0x1e, 0x3c, 0x78, 0xf0, 0xfd, 0xe7, 0xd3, 0xbb, 0x6b, 0xd6, 0xb1, 0x7f, 0xfe, 0xe1, 0xdf, 0xa3, 0x5b, 0xb6, 0x71, 0xe2, 0xd9, 0xaf, 0x43, 0x86, 0x11, 0x22, 0x44, 0x88, 0xd, 0x1a, 0x34, 0x68, 0xd0, 0xbd, 0x67, 0xce, 0x81, 0x1f, 0x3e, 0x7c, 0xf8, 0xed, 0xc7, 0x93, 0x3b, 0x76, 0xec, 0xc5, 0x97, 0x33, 0x66, 0xcc, 0x85, 0x17, 0x2e, 0x5c, 0xb8, 0x6d, 0xda, 0xa9, 0x4f, 0x9e, 0x21, 0x42, 0x84, 0x15, 0x2a, 0x54, 0xa8, 0x4d, 0x9a, 0x29, 0x52, 0xa4, 0x55, 0xaa, 0x49, 0x92, 0x39, 0x72, 0xe4, 0xd5, 0xb7, 0x73, 0xe6, 0xd1, 0xbf, 0x63, 0xc6, 0x91, 0x3f, 0x7e, 0xfc, 0xe5, 0xd7, 0xb3, 0x7b, 0xf6, 0xf1, 0xff, 0xe3, 0xdb, 0xab, 0x4b, 0x96, 0x31, 0x62, 0xc4, 0x95, 0x37, 0x6e, 0xdc, 0xa5, 0x57, 0xae, 0x41, 0x82, 0x19, 0x32, 0x64, 0xc8, 0x8d, 0x7, 0xe, 0x1c, 0x38, 0x70, 0xe0, 0xdd, 0xa7, 0x53, 0xa6, 0x51, 0xa2, 0x59, 0xb2, 0x79, 0xf2, 0xf9, 0xef, 0xc3, 0x9b, 0x2b, 0x56, 0xac, 0x45, 0x8a, 0x9, 0x12, 0x24, 0x48, 0x90, 0x3d, 0x7a, 0xf4, 0xf5, 0xf7, 0xf3, 0xfb, 0xeb, 0xcb, 0x8b, 0xb, 0x16, 0x2c, 0x58, 0xb0, 0x7d, 0xfa, 0xe9, 0xcf, 0x83, 0x1b, 0x36, 0x6c, 0xd8, 0xad, 0x47, 0x8e, 0x1}
|
||||
|
||||
func galAdd(a, b byte) byte {
|
||||
return a ^ b
|
||||
}
|
||||
|
||||
func galSub(a, b byte) byte {
|
||||
return a ^ b
|
||||
}
|
||||
|
||||
// Table from https://github.com/templexxx/reedsolomon
|
||||
var invTable = [256]byte{0x0, 0x1, 0x8e, 0xf4, 0x47, 0xa7, 0x7a, 0xba, 0xad, 0x9d, 0xdd, 0x98, 0x3d, 0xaa, 0x5d, 0x96, 0xd8, 0x72, 0xc0, 0x58, 0xe0, 0x3e, 0x4c, 0x66, 0x90, 0xde, 0x55, 0x80, 0xa0, 0x83, 0x4b, 0x2a, 0x6c, 0xed, 0x39, 0x51, 0x60, 0x56, 0x2c, 0x8a, 0x70, 0xd0, 0x1f, 0x4a, 0x26, 0x8b, 0x33, 0x6e, 0x48, 0x89, 0x6f, 0x2e, 0xa4, 0xc3, 0x40, 0x5e, 0x50, 0x22, 0xcf, 0xa9, 0xab, 0xc, 0x15, 0xe1, 0x36, 0x5f, 0xf8, 0xd5, 0x92, 0x4e, 0xa6, 0x4, 0x30, 0x88, 0x2b, 0x1e, 0x16, 0x67, 0x45, 0x93, 0x38, 0x23, 0x68, 0x8c, 0x81, 0x1a, 0x25, 0x61, 0x13, 0xc1, 0xcb, 0x63, 0x97, 0xe, 0x37, 0x41, 0x24, 0x57, 0xca, 0x5b, 0xb9, 0xc4, 0x17, 0x4d, 0x52, 0x8d, 0xef, 0xb3, 0x20, 0xec, 0x2f, 0x32, 0x28, 0xd1, 0x11, 0xd9, 0xe9, 0xfb, 0xda, 0x79, 0xdb, 0x77, 0x6, 0xbb, 0x84, 0xcd, 0xfe, 0xfc, 0x1b, 0x54, 0xa1, 0x1d, 0x7c, 0xcc, 0xe4, 0xb0, 0x49, 0x31, 0x27, 0x2d, 0x53, 0x69, 0x2, 0xf5, 0x18, 0xdf, 0x44, 0x4f, 0x9b, 0xbc, 0xf, 0x5c, 0xb, 0xdc, 0xbd, 0x94, 0xac, 0x9, 0xc7, 0xa2, 0x1c, 0x82, 0x9f, 0xc6, 0x34, 0xc2, 0x46, 0x5, 0xce, 0x3b, 0xd, 0x3c, 0x9c, 0x8, 0xbe, 0xb7, 0x87, 0xe5, 0xee, 0x6b, 0xeb, 0xf2, 0xbf, 0xaf, 0xc5, 0x64, 0x7, 0x7b, 0x95, 0x9a, 0xae, 0xb6, 0x12, 0x59, 0xa5, 0x35, 0x65, 0xb8, 0xa3, 0x9e, 0xd2, 0xf7, 0x62, 0x5a, 0x85, 0x7d, 0xa8, 0x3a, 0x29, 0x71, 0xc8, 0xf6, 0xf9, 0x43, 0xd7, 0xd6, 0x10, 0x73, 0x76, 0x78, 0x99, 0xa, 0x19, 0x91, 0x14, 0x3f, 0xe6, 0xf0, 0x86, 0xb1, 0xe2, 0xf1, 0xfa, 0x74, 0xf3, 0xb4, 0x6d, 0x21, 0xb2, 0x6a, 0xe3, 0xe7, 0xb5, 0xea, 0x3, 0x8f, 0xd3, 0xc9, 0x42, 0xd4, 0xe8, 0x75, 0x7f, 0xff, 0x7e, 0xfd}
|
||||
|
||||
@@ -883,6 +879,15 @@ func galDivide(a, b byte) byte {
|
||||
if logResult < 0 {
|
||||
logResult += 255
|
||||
}
|
||||
return expTable[uint8(logResult)]
|
||||
}
|
||||
|
||||
// galOneOver is the same as galDivide(1, a).
|
||||
func galOneOver(a byte) byte {
|
||||
if a == 0 {
|
||||
panic("Argument 'divisor' is 0")
|
||||
}
|
||||
logResult := logTable[a] ^ 255
|
||||
return expTable[logResult]
|
||||
}
|
||||
|
||||
@@ -902,7 +907,7 @@ func galExp(a byte, n int) byte {
|
||||
for logResult >= 255 {
|
||||
logResult -= 255
|
||||
}
|
||||
return expTable[logResult]
|
||||
return expTable[uint8(logResult)]
|
||||
}
|
||||
|
||||
func genAvx2Matrix(matrixRows [][]byte, inputs, inIdx, outputs int, dst []byte) []byte {
|
||||
|
||||
+3
-11
@@ -1,10 +1,11 @@
|
||||
//go:build !noasm && !appengine && !gccgo
|
||||
// +build !noasm,!appengine,!gccgo
|
||||
//go:build !noasm && !appengine && !gccgo && !nopshufb
|
||||
|
||||
// Copyright 2015, Klaus Post, see LICENSE for details.
|
||||
|
||||
package reedsolomon
|
||||
|
||||
const pshufb = true
|
||||
|
||||
//go:noescape
|
||||
func galMulSSSE3(low, high, in, out []byte)
|
||||
|
||||
@@ -17,21 +18,12 @@ func galMulAVX2Xor(low, high, in, out []byte)
|
||||
//go:noescape
|
||||
func galMulAVX2(low, high, in, out []byte)
|
||||
|
||||
//go:noescape
|
||||
func sSE2XorSlice(in, out []byte)
|
||||
|
||||
//go:noescape
|
||||
func galMulAVX2Xor_64(low, high, in, out []byte)
|
||||
|
||||
//go:noescape
|
||||
func galMulAVX2_64(low, high, in, out []byte)
|
||||
|
||||
//go:noescape
|
||||
func sSE2XorSlice_64(in, out []byte)
|
||||
|
||||
//go:noescape
|
||||
func avx2XorSlice_64(in, out []byte)
|
||||
|
||||
// This is what the assembler routines do in blocks of 16 bytes:
|
||||
/*
|
||||
func galMulSSSE3(low, high, in, out []byte) {
|
||||
|
||||
+1
-85
@@ -1,6 +1,7 @@
|
||||
//+build !noasm
|
||||
//+build !appengine
|
||||
//+build !gccgo
|
||||
//+build !nopshufb
|
||||
|
||||
// Copyright 2015, Klaus Post, see LICENSE for details.
|
||||
|
||||
@@ -215,28 +216,6 @@ done_avx2:
|
||||
VZEROUPPER
|
||||
RET
|
||||
|
||||
// func sSE2XorSlice(in, out []byte)
|
||||
TEXT ·sSE2XorSlice(SB), 7, $0
|
||||
MOVQ in+0(FP), SI // SI: &in
|
||||
MOVQ in_len+8(FP), R9 // R9: len(in)
|
||||
MOVQ out+24(FP), DX // DX: &out
|
||||
SHRQ $4, R9 // len(in) / 16
|
||||
CMPQ R9, $0
|
||||
JEQ done_xor_sse2
|
||||
|
||||
loopback_xor_sse2:
|
||||
MOVOU (SI), X0 // in[x]
|
||||
MOVOU (DX), X1 // out[x]
|
||||
PXOR X0, X1
|
||||
MOVOU X1, (DX)
|
||||
ADDQ $16, SI // in+=16
|
||||
ADDQ $16, DX // out+=16
|
||||
SUBQ $1, R9
|
||||
JNZ loopback_xor_sse2
|
||||
|
||||
done_xor_sse2:
|
||||
RET
|
||||
|
||||
// func galMulAVX2Xor_64(low, high, in, out []byte)
|
||||
TEXT ·galMulAVX2Xor_64(SB), 7, $0
|
||||
MOVQ low+0(FP), SI // SI: &low
|
||||
@@ -329,66 +308,3 @@ loopback_avx2_64:
|
||||
done_avx2_64:
|
||||
VZEROUPPER
|
||||
RET
|
||||
|
||||
// func sSE2XorSlice_64(in, out []byte)
|
||||
TEXT ·sSE2XorSlice_64(SB), 7, $0
|
||||
MOVQ in+0(FP), SI // SI: &in
|
||||
MOVQ in_len+8(FP), R9 // R9: len(in)
|
||||
MOVQ out+24(FP), DX // DX: &out
|
||||
SHRQ $6, R9 // len(in) / 64
|
||||
CMPQ R9, $0
|
||||
JEQ done_xor_sse2_64
|
||||
|
||||
loopback_xor_sse2_64:
|
||||
MOVOU (SI), X0 // in[x]
|
||||
MOVOU 16(SI), X2 // in[x]
|
||||
MOVOU 32(SI), X4 // in[x]
|
||||
MOVOU 48(SI), X6 // in[x]
|
||||
MOVOU (DX), X1 // out[x]
|
||||
MOVOU 16(DX), X3 // out[x]
|
||||
MOVOU 32(DX), X5 // out[x]
|
||||
MOVOU 48(DX), X7 // out[x]
|
||||
PXOR X0, X1
|
||||
PXOR X2, X3
|
||||
PXOR X4, X5
|
||||
PXOR X6, X7
|
||||
MOVOU X1, (DX)
|
||||
MOVOU X3, 16(DX)
|
||||
MOVOU X5, 32(DX)
|
||||
MOVOU X7, 48(DX)
|
||||
ADDQ $64, SI // in+=64
|
||||
ADDQ $64, DX // out+=64
|
||||
SUBQ $1, R9
|
||||
JNZ loopback_xor_sse2_64
|
||||
|
||||
done_xor_sse2_64:
|
||||
RET
|
||||
|
||||
// func avx2XorSlice_64(in, out []byte)
|
||||
TEXT ·avx2XorSlice_64(SB), 7, $0
|
||||
MOVQ in+0(FP), SI // SI: &in
|
||||
MOVQ in_len+8(FP), R9 // R9: len(in)
|
||||
MOVQ out+24(FP), DX // DX: &out
|
||||
SHRQ $6, R9 // len(in) / 64
|
||||
CMPQ R9, $0
|
||||
JEQ done_xor_avx2_64
|
||||
|
||||
loopback_xor_avx2_64:
|
||||
VMOVDQU (SI), Y0
|
||||
VMOVDQU 32(SI), Y2
|
||||
VMOVDQU (DX), Y1
|
||||
VMOVDQU 32(DX), Y3
|
||||
VPXOR Y0, Y1, Y1
|
||||
VPXOR Y2, Y3, Y3
|
||||
VMOVDQU Y1, (DX)
|
||||
VMOVDQU Y3, 32(DX)
|
||||
|
||||
ADDQ $64, SI // in+=64
|
||||
ADDQ $64, DX // out+=64
|
||||
SUBQ $1, R9
|
||||
JNZ loopback_xor_avx2_64
|
||||
VZEROUPPER
|
||||
|
||||
done_xor_avx2_64:
|
||||
|
||||
RET
|
||||
|
||||
+5
-21
@@ -1,20 +1,18 @@
|
||||
//go:build !noasm && !appengine && !gccgo
|
||||
// +build !noasm,!appengine,!gccgo
|
||||
//go:build !noasm && !appengine && !gccgo && !nopshufb
|
||||
|
||||
// Copyright 2015, Klaus Post, see LICENSE for details.
|
||||
// Copyright 2017, Minio, Inc.
|
||||
|
||||
package reedsolomon
|
||||
|
||||
const pshufb = true
|
||||
|
||||
//go:noescape
|
||||
func galMulNEON(low, high, in, out []byte)
|
||||
|
||||
//go:noescape
|
||||
func galMulXorNEON(low, high, in, out []byte)
|
||||
|
||||
//go:noescape
|
||||
func galXorNEON(in, out []byte)
|
||||
|
||||
func galMulSlice(c byte, in, out []byte, o *options) {
|
||||
if c == 1 {
|
||||
copy(out, in)
|
||||
@@ -51,20 +49,6 @@ func galMulSliceXor(c byte, in, out []byte, o *options) {
|
||||
}
|
||||
}
|
||||
|
||||
// simple slice xor
|
||||
func sliceXor(in, out []byte, o *options) {
|
||||
|
||||
galXorNEON(in, out)
|
||||
done := (len(in) >> 5) << 5
|
||||
|
||||
remain := len(in) - done
|
||||
if remain > 0 {
|
||||
for i := done; i < len(in); i++ {
|
||||
out[i] ^= in[i]
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
// 4-way butterfly
|
||||
func ifftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
|
||||
ifftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
|
||||
@@ -90,7 +74,7 @@ func fftDIT2(x, y []byte, log_m ffe, o *options) {
|
||||
// Reference version:
|
||||
refMulAdd(x, y, log_m)
|
||||
// 64 byte aligned, always full.
|
||||
galXorNEON(x, y)
|
||||
xorSliceNEON(x, y)
|
||||
}
|
||||
|
||||
// 2-way butterfly forward
|
||||
@@ -103,7 +87,7 @@ func fftDIT28(x, y []byte, log_m ffe8, o *options) {
|
||||
// 2-way butterfly
|
||||
func ifftDIT2(x, y []byte, log_m ffe, o *options) {
|
||||
// 64 byte aligned, always full.
|
||||
galXorNEON(x, y)
|
||||
xorSliceNEON(x, y)
|
||||
// Reference version:
|
||||
refMulAdd(x, y, log_m)
|
||||
}
|
||||
|
||||
+1
-26
@@ -1,6 +1,7 @@
|
||||
//+build !noasm
|
||||
//+build !appengine
|
||||
//+build !gccgo
|
||||
//+build !nopshufb
|
||||
|
||||
// Copyright 2015, Klaus Post, see LICENSE for details.
|
||||
// Copyright 2017, Minio, Inc.
|
||||
@@ -99,29 +100,3 @@ loopXor:
|
||||
|
||||
completeXor:
|
||||
RET
|
||||
|
||||
// func galXorNEON(in, out []byte)
|
||||
TEXT ·galXorNEON(SB), 7, $0
|
||||
MOVD in_base+0(FP), R1
|
||||
MOVD in_len+8(FP), R2 // length of message
|
||||
MOVD out_base+24(FP), R5
|
||||
SUBS $32, R2
|
||||
BMI completeXor
|
||||
|
||||
loopXor:
|
||||
// Main loop
|
||||
VLD1.P 32(R1), [V0.B16, V1.B16]
|
||||
VLD1 (R5), [V20.B16, V21.B16]
|
||||
|
||||
VEOR V20.B16, V0.B16, V4.B16
|
||||
VEOR V21.B16, V1.B16, V5.B16
|
||||
|
||||
// Store result
|
||||
VST1.P [V4.D2, V5.D2], 32(R5)
|
||||
|
||||
SUBS $32, R2
|
||||
BPL loopXor
|
||||
|
||||
completeXor:
|
||||
RET
|
||||
|
||||
|
||||
+10
-1
@@ -1,11 +1,20 @@
|
||||
// Code generated by command: go run gen.go -out ../galois_gen_amd64.s -stubs ../galois_gen_amd64.go -pkg=reedsolomon. DO NOT EDIT.
|
||||
|
||||
//go:build !appengine && !noasm && !nogen && gc
|
||||
//go:build !appengine && !noasm && !nogen && !nopshufb && gc
|
||||
|
||||
package reedsolomon
|
||||
|
||||
func _dummy_()
|
||||
|
||||
//go:noescape
|
||||
func sSE2XorSlice(in []byte, out []byte)
|
||||
|
||||
//go:noescape
|
||||
func sSE2XorSlice_64(in []byte, out []byte)
|
||||
|
||||
//go:noescape
|
||||
func avx2XorSlice_64(in []byte, out []byte)
|
||||
|
||||
// mulAvxTwo_1x1 takes 1 inputs and produces 1 outputs.
|
||||
// The output is initialized to 0.
|
||||
//
|
||||
|
||||
+93
-1
@@ -1,6 +1,6 @@
|
||||
// Code generated by command: go run gen.go -out ../galois_gen_amd64.s -stubs ../galois_gen_amd64.go -pkg=reedsolomon. DO NOT EDIT.
|
||||
|
||||
//go:build !appengine && !noasm && !nogen && gc
|
||||
//go:build !appengine && !noasm && !nogen && !nopshufb && gc
|
||||
|
||||
#include "textflag.h"
|
||||
|
||||
@@ -18,6 +18,98 @@ TEXT ·_dummy_(SB), $0
|
||||
#endif
|
||||
RET
|
||||
|
||||
// sSE2XorSlice will XOR in with out and store in out.
|
||||
// Processes 16 bytes/loop.
|
||||
|
||||
// func sSE2XorSlice(in []byte, out []byte)
|
||||
// Requires: SSE2
|
||||
TEXT ·sSE2XorSlice(SB), $0-48
|
||||
MOVQ in_base+0(FP), AX
|
||||
MOVQ out_base+24(FP), CX
|
||||
MOVQ in_len+8(FP), DX
|
||||
SHRQ $0x04, DX
|
||||
JZ end
|
||||
|
||||
loop:
|
||||
MOVOU (AX), X0
|
||||
MOVOU (CX), X1
|
||||
PXOR X0, X1
|
||||
MOVOU X1, (CX)
|
||||
ADDQ $0x10, AX
|
||||
ADDQ $0x10, CX
|
||||
DECQ DX
|
||||
JNZ loop
|
||||
|
||||
end:
|
||||
RET
|
||||
|
||||
// sSE2XorSlice_64 will XOR in with out and store in out.
|
||||
// Processes 64 bytes/loop.
|
||||
|
||||
// func sSE2XorSlice_64(in []byte, out []byte)
|
||||
// Requires: SSE2
|
||||
TEXT ·sSE2XorSlice_64(SB), $0-48
|
||||
MOVQ in_base+0(FP), AX
|
||||
MOVQ out_base+24(FP), CX
|
||||
MOVQ in_len+8(FP), DX
|
||||
SHRQ $0x06, DX
|
||||
JZ end
|
||||
|
||||
loop:
|
||||
MOVOU (AX), X0
|
||||
MOVOU 16(AX), X2
|
||||
MOVOU 32(AX), X4
|
||||
MOVOU 48(AX), X6
|
||||
MOVOU (CX), X1
|
||||
MOVOU 16(CX), X3
|
||||
MOVOU 32(CX), X5
|
||||
MOVOU 48(CX), X7
|
||||
PXOR X0, X1
|
||||
PXOR X2, X3
|
||||
PXOR X4, X5
|
||||
PXOR X6, X7
|
||||
MOVOU X1, (CX)
|
||||
MOVOU X3, 16(CX)
|
||||
MOVOU X5, 32(CX)
|
||||
MOVOU X7, 48(CX)
|
||||
ADDQ $0x40, AX
|
||||
ADDQ $0x40, CX
|
||||
DECQ DX
|
||||
JNZ loop
|
||||
|
||||
end:
|
||||
RET
|
||||
|
||||
// avx2XorSlice_64 will XOR in with out and store in out.
|
||||
// Processes 64 bytes/loop.
|
||||
|
||||
// func avx2XorSlice_64(in []byte, out []byte)
|
||||
// Requires: AVX, AVX2
|
||||
TEXT ·avx2XorSlice_64(SB), $0-48
|
||||
MOVQ in_base+0(FP), AX
|
||||
MOVQ out_base+24(FP), CX
|
||||
MOVQ in_len+8(FP), DX
|
||||
SHRQ $0x06, DX
|
||||
JZ end
|
||||
|
||||
loop:
|
||||
VMOVDQU (AX), Y0
|
||||
VMOVDQU 32(AX), Y2
|
||||
VMOVDQU (CX), Y1
|
||||
VMOVDQU 32(CX), Y3
|
||||
VPXOR Y0, Y1, Y1
|
||||
VPXOR Y2, Y3, Y3
|
||||
VMOVDQU Y1, (CX)
|
||||
VMOVDQU Y3, 32(CX)
|
||||
ADDQ $0x40, AX
|
||||
ADDQ $0x40, CX
|
||||
DECQ DX
|
||||
JNZ loop
|
||||
|
||||
end:
|
||||
VZEROUPPER
|
||||
RET
|
||||
|
||||
// func mulAvxTwo_1x1(matrix []byte, in [][]byte, out [][]byte, start int, n int)
|
||||
// Requires: AVX, AVX2, SSE2
|
||||
TEXT ·mulAvxTwo_1x1(SB), NOSPLIT, $0-88
|
||||
|
||||
-1
@@ -1,5 +1,4 @@
|
||||
//go:build !amd64 || noasm || appengine || gccgo || nogen
|
||||
// +build !amd64 noasm appengine gccgo nogen
|
||||
|
||||
package reedsolomon
|
||||
|
||||
|
||||
+1164
File diff suppressed because it is too large
Load Diff
+33101
File diff suppressed because it is too large
Load Diff
+2
-2
@@ -1,7 +1,7 @@
|
||||
// Code generated by command: go generate gen.go. DO NOT EDIT.
|
||||
|
||||
//go:build !appengine && !noasm && gc && !nogen
|
||||
// +build !appengine,!noasm,gc,!nogen
|
||||
//go:build !appengine && !noasm && gc && !nogen && !nopshufb
|
||||
// +build !appengine,!noasm,gc,!nogen,!nopshufb
|
||||
|
||||
package reedsolomon
|
||||
|
||||
|
||||
+697
@@ -0,0 +1,697 @@
|
||||
// Code generated by command: go generate gen.go. DO NOT EDIT.
|
||||
|
||||
//go:build !appengine && !noasm && gc && !nogen && nopshufb
|
||||
// +build !appengine,!noasm,gc,!nogen,nopshufb
|
||||
|
||||
package reedsolomon
|
||||
|
||||
import (
|
||||
"fmt"
|
||||
)
|
||||
|
||||
const (
|
||||
avx2CodeGen = true
|
||||
maxAvx2Inputs = 10
|
||||
maxAvx2Outputs = 10
|
||||
minAvx2Size = 64
|
||||
avxSizeMask = maxInt - (minAvx2Size - 1)
|
||||
)
|
||||
|
||||
func galMulSlicesAvx2(matrix []byte, in, out [][]byte, start, stop int) int { panic(`no pshufb`) }
|
||||
func galMulSlicesAvx2Xor(matrix []byte, in, out [][]byte, start, stop int) int { panic(`no pshufb`) }
|
||||
|
||||
func galMulSlicesGFNI(matrix []uint64, in, out [][]byte, start, stop int) int {
|
||||
n := (stop - start) & avxSizeMask
|
||||
|
||||
switch len(in) {
|
||||
case 1:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_1x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_1x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_1x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_1x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_1x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_1x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_1x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_1x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_1x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_1x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 2:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_2x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_2x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_2x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_2x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_2x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_2x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_2x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_2x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_2x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_2x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 3:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_3x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_3x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_3x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_3x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_3x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_3x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_3x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_3x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_3x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_3x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 4:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_4x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_4x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_4x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_4x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_4x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_4x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_4x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_4x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_4x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_4x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 5:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_5x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_5x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_5x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_5x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_5x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_5x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_5x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_5x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_5x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_5x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 6:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_6x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_6x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_6x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_6x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_6x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_6x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_6x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_6x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_6x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_6x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 7:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_7x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_7x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_7x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_7x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_7x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_7x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_7x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_7x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_7x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_7x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 8:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_8x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_8x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_8x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_8x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_8x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_8x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_8x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_8x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_8x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_8x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 9:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_9x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_9x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_9x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_9x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_9x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_9x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_9x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_9x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_9x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_9x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 10:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_10x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_10x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_10x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_10x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_10x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_10x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_10x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_10x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_10x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_10x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
}
|
||||
panic(fmt.Sprintf("unhandled size: %dx%d", len(in), len(out)))
|
||||
}
|
||||
|
||||
func galMulSlicesGFNIXor(matrix []uint64, in, out [][]byte, start, stop int) int {
|
||||
n := (stop - start) & avxSizeMask
|
||||
|
||||
switch len(in) {
|
||||
case 1:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_1x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_1x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_1x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_1x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_1x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_1x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_1x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_1x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_1x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_1x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 2:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_2x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_2x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_2x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_2x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_2x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_2x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_2x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_2x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_2x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_2x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 3:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_3x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_3x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_3x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_3x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_3x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_3x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_3x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_3x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_3x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_3x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 4:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_4x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_4x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_4x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_4x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_4x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_4x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_4x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_4x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_4x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_4x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 5:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_5x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_5x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_5x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_5x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_5x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_5x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_5x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_5x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_5x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_5x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 6:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_6x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_6x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_6x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_6x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_6x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_6x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_6x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_6x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_6x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_6x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 7:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_7x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_7x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_7x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_7x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_7x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_7x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_7x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_7x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_7x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_7x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 8:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_8x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_8x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_8x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_8x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_8x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_8x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_8x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_8x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_8x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_8x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 9:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_9x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_9x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_9x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_9x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_9x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_9x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_9x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_9x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_9x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_9x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 10:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_10x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_10x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_10x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_10x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_10x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_10x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_10x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_10x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_10x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_10x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
}
|
||||
panic(fmt.Sprintf("unhandled size: %dx%d", len(in), len(out)))
|
||||
}
|
||||
+3
-9
@@ -1,12 +1,11 @@
|
||||
//go:build (!amd64 || noasm || appengine || gccgo) && (!arm64 || noasm || appengine || gccgo) && (!ppc64le || noasm || appengine || gccgo)
|
||||
// +build !amd64 noasm appengine gccgo
|
||||
// +build !arm64 noasm appengine gccgo
|
||||
// +build !ppc64le noasm appengine gccgo
|
||||
//go:build (!amd64 || noasm || appengine || gccgo) && (!arm64 || noasm || appengine || gccgo || nopshufb) && (!ppc64le || noasm || appengine || gccgo || nopshufb)
|
||||
|
||||
// Copyright 2015, Klaus Post, see LICENSE for details.
|
||||
|
||||
package reedsolomon
|
||||
|
||||
const pshufb = false
|
||||
|
||||
func galMulSlice(c byte, in, out []byte, o *options) {
|
||||
out = out[:len(in)]
|
||||
if c == 1 {
|
||||
@@ -31,11 +30,6 @@ func galMulSliceXor(c byte, in, out []byte, o *options) {
|
||||
}
|
||||
}
|
||||
|
||||
// simple slice xor
|
||||
func sliceXor(in, out []byte, o *options) {
|
||||
sliceXorGo(in, out, o)
|
||||
}
|
||||
|
||||
func init() {
|
||||
defaultOptions.useAVX512 = false
|
||||
}
|
||||
|
||||
+146
@@ -0,0 +1,146 @@
|
||||
// Copyright 2015, Klaus Post, see LICENSE for details
|
||||
|
||||
//go:build nopshufb && !noasm
|
||||
|
||||
package reedsolomon
|
||||
|
||||
// bigSwitchover is the size where 64 bytes are processed per loop.
|
||||
const bigSwitchover = 128
|
||||
|
||||
const pshufb = false
|
||||
|
||||
// simple slice xor
|
||||
func sliceXor(in, out []byte, o *options) {
|
||||
if o.useSSE2 {
|
||||
if len(in) >= bigSwitchover {
|
||||
if o.useAVX2 {
|
||||
avx2XorSlice_64(in, out)
|
||||
done := (len(in) >> 6) << 6
|
||||
in = in[done:]
|
||||
out = out[done:]
|
||||
} else {
|
||||
sSE2XorSlice_64(in, out)
|
||||
done := (len(in) >> 6) << 6
|
||||
in = in[done:]
|
||||
out = out[done:]
|
||||
}
|
||||
}
|
||||
if len(in) >= 16 {
|
||||
sSE2XorSlice(in, out)
|
||||
done := (len(in) >> 4) << 4
|
||||
in = in[done:]
|
||||
out = out[done:]
|
||||
}
|
||||
} else {
|
||||
sliceXorGo(in, out, o)
|
||||
return
|
||||
}
|
||||
out = out[:len(in)]
|
||||
for i := range in {
|
||||
out[i] ^= in[i]
|
||||
}
|
||||
}
|
||||
|
||||
func galMulSlice(c byte, in, out []byte, o *options) {
|
||||
out = out[:len(in)]
|
||||
if c == 1 {
|
||||
copy(out, in)
|
||||
return
|
||||
}
|
||||
mt := mulTable[c][:256]
|
||||
for len(in) >= 4 {
|
||||
ii := (*[4]byte)(in)
|
||||
oo := (*[4]byte)(out)
|
||||
oo[0] = mt[ii[0]]
|
||||
oo[1] = mt[ii[1]]
|
||||
oo[2] = mt[ii[2]]
|
||||
oo[3] = mt[ii[3]]
|
||||
in = in[4:]
|
||||
out = out[4:]
|
||||
}
|
||||
for n, input := range in {
|
||||
out[n] = mt[input]
|
||||
}
|
||||
}
|
||||
|
||||
func galMulSliceXor(c byte, in, out []byte, o *options) {
|
||||
out = out[:len(in)]
|
||||
if c == 1 {
|
||||
sliceXor(in, out, o)
|
||||
return
|
||||
}
|
||||
mt := mulTable[c][:256]
|
||||
for len(in) >= 4 {
|
||||
ii := (*[4]byte)(in)
|
||||
oo := (*[4]byte)(out)
|
||||
oo[0] ^= mt[ii[0]]
|
||||
oo[1] ^= mt[ii[1]]
|
||||
oo[2] ^= mt[ii[2]]
|
||||
oo[3] ^= mt[ii[3]]
|
||||
in = in[4:]
|
||||
out = out[4:]
|
||||
}
|
||||
for n, input := range in {
|
||||
out[n] ^= mt[input]
|
||||
}
|
||||
}
|
||||
|
||||
func init() {
|
||||
defaultOptions.useAVX512 = false
|
||||
}
|
||||
|
||||
// 4-way butterfly
|
||||
func ifftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
|
||||
ifftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
|
||||
}
|
||||
|
||||
// 4-way butterfly
|
||||
func ifftDIT48(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe8, o *options) {
|
||||
ifftDIT4Ref8(work, dist, log_m01, log_m23, log_m02, o)
|
||||
}
|
||||
|
||||
// 4-way butterfly
|
||||
func fftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
|
||||
fftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
|
||||
}
|
||||
|
||||
// 4-way butterfly
|
||||
func fftDIT48(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe8, o *options) {
|
||||
fftDIT4Ref8(work, dist, log_m01, log_m23, log_m02, o)
|
||||
}
|
||||
|
||||
// 2-way butterfly forward
|
||||
func fftDIT2(x, y []byte, log_m ffe, o *options) {
|
||||
// Reference version:
|
||||
refMulAdd(x, y, log_m)
|
||||
sliceXor(x, y, o)
|
||||
}
|
||||
|
||||
// 2-way butterfly forward
|
||||
func fftDIT28(x, y []byte, log_m ffe8, o *options) {
|
||||
// Reference version:
|
||||
refMulAdd8(x, y, log_m)
|
||||
sliceXor(x, y, o)
|
||||
}
|
||||
|
||||
// 2-way butterfly inverse
|
||||
func ifftDIT2(x, y []byte, log_m ffe, o *options) {
|
||||
// Reference version:
|
||||
sliceXor(x, y, o)
|
||||
refMulAdd(x, y, log_m)
|
||||
}
|
||||
|
||||
// 2-way butterfly inverse
|
||||
func ifftDIT28(x, y []byte, log_m ffe8, o *options) {
|
||||
// Reference version:
|
||||
sliceXor(x, y, o)
|
||||
refMulAdd8(x, y, log_m)
|
||||
}
|
||||
|
||||
func mulgf16(x, y []byte, log_m ffe, o *options) {
|
||||
refMul(x, y, log_m)
|
||||
}
|
||||
|
||||
func mulgf8(x, y []byte, log_m ffe8, o *options) {
|
||||
refMul8(x, y, log_m)
|
||||
}
|
||||
+1
-2
@@ -1,5 +1,4 @@
|
||||
//go:build !amd64 || noasm || appengine || gccgo
|
||||
// +build !amd64 noasm appengine gccgo
|
||||
//go:build !amd64 || noasm || appengine || gccgo || pshufb
|
||||
|
||||
// Copyright 2020, Klaus Post, see LICENSE for details.
|
||||
|
||||
|
||||
+3
-7
@@ -1,11 +1,12 @@
|
||||
//go:build !noasm && !appengine && !gccgo
|
||||
// +build !noasm,!appengine,!gccgo
|
||||
//go:build !noasm && !appengine && !gccgo && !nopshufb
|
||||
|
||||
// Copyright 2015, Klaus Post, see LICENSE for details.
|
||||
// Copyright 2018, Minio, Inc.
|
||||
|
||||
package reedsolomon
|
||||
|
||||
const pshufb = true
|
||||
|
||||
//go:noescape
|
||||
func galMulPpc(low, high, in, out []byte)
|
||||
|
||||
@@ -66,11 +67,6 @@ func galMulSliceXor(c byte, in, out []byte, o *options) {
|
||||
}
|
||||
}
|
||||
|
||||
// slice galois add
|
||||
func sliceXor(in, out []byte, o *options) {
|
||||
sliceXorGo(in, out, o)
|
||||
}
|
||||
|
||||
// 4-way butterfly
|
||||
func ifftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
|
||||
ifftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
|
||||
|
||||
+1
@@ -1,6 +1,7 @@
|
||||
//+build !noasm
|
||||
//+build !appengine
|
||||
//+build !gccgo
|
||||
//+build !pshufb
|
||||
|
||||
// Copyright 2015, Klaus Post, see LICENSE for details.
|
||||
// Copyright 2018, Minio, Inc.
|
||||
|
||||
+1
-1
@@ -303,7 +303,7 @@ func (r *leopardFF16) Split(data []byte) ([][]byte, error) {
|
||||
// Copy partial shards
|
||||
copyFrom := data[perShard*fullShards : dataLen]
|
||||
for i := range padding {
|
||||
if len(copyFrom) <= 0 {
|
||||
if len(copyFrom) == 0 {
|
||||
break
|
||||
}
|
||||
copyFrom = copyFrom[copy(padding[i], copyFrom):]
|
||||
|
||||
+1
-1
@@ -344,7 +344,7 @@ func (r *leopardFF8) Split(data []byte) ([][]byte, error) {
|
||||
// Copy partial shards
|
||||
copyFrom := data[perShard*fullShards : dataLen]
|
||||
for i := range padding {
|
||||
if len(copyFrom) <= 0 {
|
||||
if len(copyFrom) == 0 {
|
||||
break
|
||||
}
|
||||
copyFrom = copyFrom[copy(padding[i], copyFrom):]
|
||||
|
||||
+3
-3
@@ -67,11 +67,11 @@ var errColSizeMismatch = errors.New("column size is not the same for all rows")
|
||||
|
||||
func (m matrix) Check() error {
|
||||
rows := len(m)
|
||||
if rows <= 0 {
|
||||
if rows == 0 {
|
||||
return errInvalidRowSize
|
||||
}
|
||||
cols := len(m[0])
|
||||
if cols <= 0 {
|
||||
if cols == 0 {
|
||||
return errInvalidColSize
|
||||
}
|
||||
|
||||
@@ -231,7 +231,7 @@ func (m matrix) gaussianElimination() error {
|
||||
}
|
||||
// Scale to 1.
|
||||
if m[r][r] != 1 {
|
||||
scale := galDivide(1, m[r][r])
|
||||
scale := galOneOver(m[r][r])
|
||||
for c := 0; c < columns; c++ {
|
||||
m[r][c] = galMultiply(m[r][c], scale)
|
||||
}
|
||||
|
||||
+6
-6
@@ -283,7 +283,7 @@ func buildMatrixJerasure(dataShards, totalShards int) (matrix, error) {
|
||||
// Multiply by the inverted matrix (same as vm.Multiply(vm[0:dataShards].Invert()))
|
||||
if vm[i][i] != 1 {
|
||||
// Make vm[i][i] = 1 by dividing the column by vm[i][i]
|
||||
tmp := galDivide(1, vm[i][i])
|
||||
tmp := galOneOver(vm[i][i])
|
||||
for j := 0; j < totalShards; j++ {
|
||||
vm[j][i] = galMultiply(vm[j][i], tmp)
|
||||
}
|
||||
@@ -303,7 +303,7 @@ func buildMatrixJerasure(dataShards, totalShards int) (matrix, error) {
|
||||
for j := 0; j < dataShards; j++ {
|
||||
tmp := vm[dataShards][j]
|
||||
if tmp != 1 {
|
||||
tmp = galDivide(1, tmp)
|
||||
tmp = galOneOver(tmp)
|
||||
for i := dataShards; i < totalShards; i++ {
|
||||
vm[i][j] = galMultiply(vm[i][j], tmp)
|
||||
}
|
||||
@@ -314,7 +314,7 @@ func buildMatrixJerasure(dataShards, totalShards int) (matrix, error) {
|
||||
for i := dataShards + 1; i < totalShards; i++ {
|
||||
tmp := vm[i][0]
|
||||
if tmp != 1 {
|
||||
tmp = galDivide(1, tmp)
|
||||
tmp = galOneOver(tmp)
|
||||
for j := 0; j < dataShards; j++ {
|
||||
vm[i][j] = galMultiply(vm[i][j], tmp)
|
||||
}
|
||||
@@ -652,7 +652,7 @@ func (r *reedSolomon) EncodeIdx(dataShard []byte, idx int, parity [][]byte) erro
|
||||
return ErrShardSize
|
||||
}
|
||||
|
||||
if avx2CodeGen && len(dataShard) >= r.o.perRound && len(parity) >= avx2CodeGenMinShards && (r.o.useAVX2 || r.o.useGFNI) {
|
||||
if avx2CodeGen && len(dataShard) >= r.o.perRound && len(parity) >= avx2CodeGenMinShards && ((pshufb && r.o.useAVX2) || r.o.useGFNI) {
|
||||
m := make([][]byte, r.parityShards)
|
||||
for iRow := range m {
|
||||
m[iRow] = r.parity[iRow][idx : idx+1]
|
||||
@@ -803,7 +803,7 @@ func (r *reedSolomon) Verify(shards [][]byte) (bool, error) {
|
||||
}
|
||||
|
||||
func (r *reedSolomon) canAVX2C(byteCount int, inputs, outputs int) bool {
|
||||
return avx2CodeGen && r.o.useAVX2 &&
|
||||
return avx2CodeGen && pshufb && r.o.useAVX2 &&
|
||||
byteCount >= avx2CodeGenMinSize && inputs+outputs >= avx2CodeGenMinShards &&
|
||||
inputs <= maxAvx2Inputs && outputs <= maxAvx2Outputs
|
||||
}
|
||||
@@ -1633,7 +1633,7 @@ func (r *reedSolomon) Split(data []byte) ([][]byte, error) {
|
||||
// Copy partial shards
|
||||
copyFrom := data[perShard*fullShards : dataLen]
|
||||
for i := range padding {
|
||||
if len(copyFrom) <= 0 {
|
||||
if len(copyFrom) == 0 {
|
||||
break
|
||||
}
|
||||
copyFrom = copyFrom[copy(padding[i], copyFrom):]
|
||||
|
||||
+19
@@ -0,0 +1,19 @@
|
||||
//go:build !noasm && !appengine && !gccgo
|
||||
|
||||
package reedsolomon
|
||||
|
||||
//go:noescape
|
||||
func xorSliceNEON(in, out []byte)
|
||||
|
||||
// simple slice xor
|
||||
func sliceXor(in, out []byte, o *options) {
|
||||
xorSliceNEON(in, out)
|
||||
done := (len(in) >> 5) << 5
|
||||
|
||||
remain := len(in) - done
|
||||
if remain > 0 {
|
||||
for i := done; i < len(in); i++ {
|
||||
out[i] ^= in[i]
|
||||
}
|
||||
}
|
||||
}
|
||||
+29
@@ -0,0 +1,29 @@
|
||||
//+build !noasm
|
||||
//+build !appengine
|
||||
//+build !gccgo
|
||||
|
||||
// func xorSliceNEON(in, out []byte)
|
||||
TEXT ·xorSliceNEON(SB), 7, $0
|
||||
MOVD in_base+0(FP), R1
|
||||
MOVD in_len+8(FP), R2 // length of message
|
||||
MOVD out_base+24(FP), R5
|
||||
SUBS $32, R2
|
||||
BMI completeXor
|
||||
|
||||
loopXor:
|
||||
// Main loop
|
||||
VLD1.P 32(R1), [V0.B16, V1.B16]
|
||||
VLD1 (R5), [V20.B16, V21.B16]
|
||||
|
||||
VEOR V20.B16, V0.B16, V4.B16
|
||||
VEOR V21.B16, V1.B16, V5.B16
|
||||
|
||||
// Store result
|
||||
VST1.P [V4.D2, V5.D2], 32(R5)
|
||||
|
||||
SUBS $32, R2
|
||||
BPL loopXor
|
||||
|
||||
completeXor:
|
||||
RET
|
||||
|
||||
+7
@@ -0,0 +1,7 @@
|
||||
//go:build noasm || gccgo || appengine || (!amd64 && !arm64)
|
||||
|
||||
package reedsolomon
|
||||
|
||||
func sliceXor(in, out []byte, o *options) {
|
||||
sliceXorGo(in, out, o)
|
||||
}
|
||||
+39
-25
@@ -3,6 +3,7 @@ package kcp
|
||||
import (
|
||||
"encoding/binary"
|
||||
"sync/atomic"
|
||||
"time"
|
||||
|
||||
"github.com/klauspost/reedsolomon"
|
||||
)
|
||||
@@ -45,7 +46,8 @@ type fecDecoder struct {
|
||||
codec reedsolomon.Encoder
|
||||
|
||||
// auto tune fec parameter
|
||||
autoTune autoTune
|
||||
autoTune autoTune
|
||||
shouldTune bool
|
||||
}
|
||||
|
||||
func newFECDecoder(dataShards, parityShards int) *fecDecoder {
|
||||
@@ -78,18 +80,17 @@ func (dec *fecDecoder) decode(in fecPacket) (recovered [][]byte) {
|
||||
}
|
||||
|
||||
// check if FEC parameters is out of sync
|
||||
var shouldTune bool
|
||||
if int(in.seqid())%dec.shardSize < dec.dataShards {
|
||||
if in.flag() != typeData { // expect typeData
|
||||
shouldTune = true
|
||||
dec.shouldTune = true
|
||||
}
|
||||
} else {
|
||||
if in.flag() != typeParity {
|
||||
shouldTune = true
|
||||
dec.shouldTune = true
|
||||
}
|
||||
}
|
||||
|
||||
if shouldTune {
|
||||
if dec.shouldTune {
|
||||
autoDS := dec.autoTune.FindPeriod(true)
|
||||
autoPS := dec.autoTune.FindPeriod(false)
|
||||
|
||||
@@ -108,11 +109,17 @@ func (dec *fecDecoder) decode(in fecPacket) (recovered [][]byte) {
|
||||
dec.codec = codec
|
||||
dec.decodeCache = make([][]byte, dec.shardSize)
|
||||
dec.flagCache = make([]bool, dec.shardSize)
|
||||
dec.shouldTune = false
|
||||
//log.Println("autotune to :", dec.dataShards, dec.parityShards)
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
// parameters in tuning
|
||||
if dec.shouldTune {
|
||||
return nil
|
||||
}
|
||||
|
||||
// insertion
|
||||
n := len(dec.rx) - 1
|
||||
insertIdx := 0
|
||||
@@ -272,8 +279,9 @@ type (
|
||||
payloadOffset int // FEC payload offset
|
||||
|
||||
// caches
|
||||
shardCache [][]byte
|
||||
encodeCache [][]byte
|
||||
shardCache [][]byte
|
||||
encodeCache [][]byte
|
||||
tsLatestPacket int64
|
||||
|
||||
// RS encoder
|
||||
codec reedsolomon.Encoder
|
||||
@@ -309,7 +317,7 @@ func newFECEncoder(dataShards, parityShards, offset int) *fecEncoder {
|
||||
|
||||
// encodes the packet, outputs parity shards if we have collected quorum datashards
|
||||
// notice: the contents of 'ps' will be re-written in successive calling
|
||||
func (enc *fecEncoder) encode(b []byte) (ps [][]byte) {
|
||||
func (enc *fecEncoder) encode(b []byte, rto uint32) (ps [][]byte) {
|
||||
// The header format:
|
||||
// | FEC SEQID(4B) | FEC TYPE(2B) | SIZE (2B) | PAYLOAD(SIZE-2) |
|
||||
// |<-headerOffset |<-payloadOffset
|
||||
@@ -328,26 +336,30 @@ func (enc *fecEncoder) encode(b []byte) (ps [][]byte) {
|
||||
}
|
||||
|
||||
// Generation of Reed-Solomon Erasure Code
|
||||
now := time.Now().UnixMilli()
|
||||
if enc.shardCount == enc.dataShards {
|
||||
// fill '0' into the tail of each datashard
|
||||
for i := 0; i < enc.dataShards; i++ {
|
||||
shard := enc.shardCache[i]
|
||||
slen := len(shard)
|
||||
clear(shard[slen:enc.maxSize])
|
||||
}
|
||||
// generate the rs-code only if the data is continuous.
|
||||
if now-enc.tsLatestPacket < int64(rto) {
|
||||
// fill '0' into the tail of each datashard
|
||||
for i := 0; i < enc.dataShards; i++ {
|
||||
shard := enc.shardCache[i]
|
||||
slen := len(shard)
|
||||
clear(shard[slen:enc.maxSize])
|
||||
}
|
||||
|
||||
// construct equal-sized slice with stripped header
|
||||
cache := enc.encodeCache
|
||||
for k := range cache {
|
||||
cache[k] = enc.shardCache[k][enc.payloadOffset:enc.maxSize]
|
||||
}
|
||||
// construct equal-sized slice with stripped header
|
||||
cache := enc.encodeCache
|
||||
for k := range cache {
|
||||
cache[k] = enc.shardCache[k][enc.payloadOffset:enc.maxSize]
|
||||
}
|
||||
|
||||
// encoding
|
||||
if err := enc.codec.Encode(cache); err == nil {
|
||||
ps = enc.shardCache[enc.dataShards:]
|
||||
for k := range ps {
|
||||
enc.markParity(ps[k][enc.headerOffset:])
|
||||
ps[k] = ps[k][:enc.maxSize]
|
||||
// encoding
|
||||
if err := enc.codec.Encode(cache); err == nil {
|
||||
ps = enc.shardCache[enc.dataShards:]
|
||||
for k := range ps {
|
||||
enc.markParity(ps[k][enc.headerOffset:])
|
||||
ps[k] = ps[k][:enc.maxSize]
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
@@ -356,6 +368,8 @@ func (enc *fecEncoder) encode(b []byte) (ps [][]byte) {
|
||||
enc.maxSize = 0
|
||||
}
|
||||
|
||||
enc.tsLatestPacket = now
|
||||
|
||||
return
|
||||
}
|
||||
|
||||
|
||||
+14
-4
@@ -195,6 +195,7 @@ func newUDPSession(conv uint32, dataShards, parityShards int, l *Listener, conn
|
||||
|
||||
// Read implements net.Conn
|
||||
func (s *UDPSession) Read(b []byte) (n int, err error) {
|
||||
RESET_TIMER:
|
||||
var timeout *time.Timer
|
||||
// deadline for current reading operation
|
||||
var c <-chan time.Time
|
||||
@@ -243,6 +244,10 @@ func (s *UDPSession) Read(b []byte) (n int, err error) {
|
||||
// wait for read event or timeout or error
|
||||
select {
|
||||
case <-s.chReadEvent:
|
||||
if timeout != nil {
|
||||
timeout.Stop()
|
||||
goto RESET_TIMER
|
||||
}
|
||||
case <-c:
|
||||
return 0, errors.WithStack(errTimeout)
|
||||
case <-s.chSocketReadError:
|
||||
@@ -258,6 +263,7 @@ func (s *UDPSession) Write(b []byte) (n int, err error) { return s.WriteBuffers(
|
||||
|
||||
// WriteBuffers write a vector of byte slices to the underlying connection
|
||||
func (s *UDPSession) WriteBuffers(v [][]byte) (n int, err error) {
|
||||
RESET_TIMER:
|
||||
var timeout *time.Timer
|
||||
var c <-chan time.Time
|
||||
if !s.wd.IsZero() {
|
||||
@@ -308,6 +314,10 @@ func (s *UDPSession) WriteBuffers(v [][]byte) (n int, err error) {
|
||||
|
||||
select {
|
||||
case <-s.chWriteEvent:
|
||||
if timeout != nil {
|
||||
timeout.Stop()
|
||||
goto RESET_TIMER
|
||||
}
|
||||
case <-c:
|
||||
return 0, errors.WithStack(errTimeout)
|
||||
case <-s.chSocketWriteError:
|
||||
@@ -375,9 +385,9 @@ func (s *UDPSession) RemoteAddr() net.Addr { return s.remote }
|
||||
// SetDeadline sets the deadline associated with the listener. A zero time value disables the deadline.
|
||||
func (s *UDPSession) SetDeadline(t time.Time) error {
|
||||
s.mu.Lock()
|
||||
defer s.mu.Unlock()
|
||||
s.rd = t
|
||||
s.wd = t
|
||||
s.mu.Unlock()
|
||||
s.notifyReadEvent()
|
||||
s.notifyWriteEvent()
|
||||
return nil
|
||||
@@ -386,8 +396,8 @@ func (s *UDPSession) SetDeadline(t time.Time) error {
|
||||
// SetReadDeadline implements the Conn SetReadDeadline method.
|
||||
func (s *UDPSession) SetReadDeadline(t time.Time) error {
|
||||
s.mu.Lock()
|
||||
defer s.mu.Unlock()
|
||||
s.rd = t
|
||||
s.mu.Unlock()
|
||||
s.notifyReadEvent()
|
||||
return nil
|
||||
}
|
||||
@@ -395,8 +405,8 @@ func (s *UDPSession) SetReadDeadline(t time.Time) error {
|
||||
// SetWriteDeadline implements the Conn SetWriteDeadline method.
|
||||
func (s *UDPSession) SetWriteDeadline(t time.Time) error {
|
||||
s.mu.Lock()
|
||||
defer s.mu.Unlock()
|
||||
s.wd = t
|
||||
s.mu.Unlock()
|
||||
s.notifyWriteEvent()
|
||||
return nil
|
||||
}
|
||||
@@ -531,7 +541,7 @@ func (s *UDPSession) output(buf []byte) {
|
||||
|
||||
// 1. FEC encoding
|
||||
if s.fecEncoder != nil {
|
||||
ecc = s.fecEncoder.encode(buf)
|
||||
ecc = s.fecEncoder.encode(buf, s.kcp.rx_rto)
|
||||
}
|
||||
|
||||
// 2&3. crc32 & encryption
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !purego
|
||||
// +build !purego
|
||||
|
||||
// Package alias implements memory aliasing tests.
|
||||
package alias
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build purego
|
||||
// +build purego
|
||||
|
||||
// Package alias implements memory aliasing tests.
|
||||
package alias
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build amd64 && !purego && gc
|
||||
// +build amd64,!purego,gc
|
||||
|
||||
package salsa
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build amd64 && !purego && gc
|
||||
// +build amd64,!purego,gc
|
||||
|
||||
// This code was translated into a form compatible with 6a from the public
|
||||
// domain sources in SUPERCOP: https://bench.cr.yp.to/supercop.html
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !amd64 || purego || !gc
|
||||
// +build !amd64 purego !gc
|
||||
|
||||
package salsa
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || netbsd || openbsd
|
||||
// +build aix darwin dragonfly freebsd netbsd openbsd
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-2
@@ -3,8 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build (arm || mips || mipsle || 386 || ppc) && linux
|
||||
// +build arm mips mipsle 386 ppc
|
||||
// +build linux
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-2
@@ -3,8 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build (arm64 || amd64 || loong64 || ppc64 || ppc64le || mips64 || mips64le || riscv64 || s390x) && linux
|
||||
// +build arm64 amd64 loong64 ppc64 ppc64le mips64 mips64le riscv64 s390x
|
||||
// +build linux
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build amd64 && solaris
|
||||
// +build amd64,solaris
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !zos
|
||||
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris
|
||||
// +build darwin dragonfly freebsd linux netbsd openbsd solaris
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || windows || zos
|
||||
// +build aix windows zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,6 +3,5 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build darwin && go1.12
|
||||
// +build darwin,go1.12
|
||||
|
||||
// This exists solely so we can linkname in symbols from syscall.
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-2
@@ -3,8 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build (arm || mips || mipsle || 386 || ppc) && (darwin || dragonfly || freebsd || linux || netbsd || openbsd)
|
||||
// +build arm mips mipsle 386 ppc
|
||||
// +build darwin dragonfly freebsd linux netbsd openbsd
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-2
@@ -3,8 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build (arm64 || amd64 || loong64 || ppc64 || ppc64le || mips64 || mips64le || riscv64 || s390x) && (aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || zos)
|
||||
// +build arm64 amd64 loong64 ppc64 ppc64le mips64 mips64le riscv64 s390x
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build amd64 && solaris
|
||||
// +build amd64,solaris
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !zos
|
||||
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !linux && !netbsd
|
||||
// +build !aix,!linux,!netbsd
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || linux || netbsd
|
||||
// +build aix linux netbsd
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || netbsd || openbsd
|
||||
// +build aix darwin dragonfly freebsd netbsd openbsd
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || netbsd
|
||||
// +build aix darwin dragonfly freebsd netbsd
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-2
@@ -3,8 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build (arm || mips || mipsle || 386 || ppc) && linux
|
||||
// +build arm mips mipsle 386 ppc
|
||||
// +build linux
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-2
@@ -3,8 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build (arm64 || amd64 || loong64 || ppc64 || ppc64le || mips64 || mips64le || riscv64 || s390x) && linux
|
||||
// +build arm64 amd64 loong64 ppc64 ppc64le mips64 mips64le riscv64 s390x
|
||||
// +build linux
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build amd64 && solaris
|
||||
// +build amd64,solaris
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !zos
|
||||
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build s390x && zos
|
||||
// +build s390x,zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !race
|
||||
// +build !race
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build race
|
||||
// +build race
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build linux
|
||||
// +build linux
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || windows || zos
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris windows zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !linux
|
||||
// +build !linux
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !windows && !zos
|
||||
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!windows,!zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || openbsd || solaris
|
||||
// +build aix darwin dragonfly freebsd openbsd solaris
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build linux && !s390x && !386
|
||||
// +build linux,!s390x,!386
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build loong64
|
||||
// +build loong64
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build riscv64
|
||||
// +build riscv64
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || windows || zos
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris windows zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !windows && !zos
|
||||
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!windows,!zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
|
||||
// Added for go1.11 compatibility
|
||||
//go:build aix
|
||||
// +build aix
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -2,7 +2,6 @@
|
||||
// cgo -godefs defs_linux.go
|
||||
|
||||
//go:build loong64
|
||||
// +build loong64
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -2,7 +2,6 @@
|
||||
// cgo -godefs defs_linux.go
|
||||
|
||||
//go:build riscv64
|
||||
// +build riscv64
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || netbsd || openbsd
|
||||
// +build aix darwin dragonfly freebsd netbsd openbsd
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build darwin || linux || solaris
|
||||
// +build darwin linux solaris
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !windows && !zos
|
||||
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!windows,!zos
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !linux
|
||||
// +build !linux
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !zos
|
||||
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!zos
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || windows || zos
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris windows zos
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !windows && !zos
|
||||
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!windows,!zos
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -4,7 +4,6 @@
|
||||
|
||||
// Added for go1.11 compatibility
|
||||
//go:build aix
|
||||
// +build aix
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || netbsd || openbsd || solaris || windows
|
||||
// +build aix darwin dragonfly freebsd netbsd openbsd solaris windows
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !darwin && !dragonfly && !freebsd && !netbsd && !openbsd && !solaris && !windows
|
||||
// +build !aix,!darwin,!dragonfly,!freebsd,!netbsd,!openbsd,!solaris,!windows
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build darwin || freebsd || linux
|
||||
// +build darwin freebsd linux
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !darwin && !freebsd && !linux
|
||||
// +build !darwin,!freebsd,!linux
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build linux
|
||||
// +build linux
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !linux
|
||||
// +build !linux
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build netbsd || openbsd
|
||||
// +build netbsd openbsd
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build darwin || freebsd || linux || solaris
|
||||
// +build darwin freebsd linux solaris
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !darwin && !freebsd && !linux && !solaris
|
||||
// +build !darwin,!freebsd,!linux,!solaris
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
Some files were not shown because too many files have changed in this diff Show More
Reference in New Issue
Block a user