mirror of
https://github.com/xtaci/kcptun.git
synced 2024-04-21 12:32:32 +00:00
Compare commits
| Author | SHA1 | Date | |
|---|---|---|---|
|
|
8929bb029d | ||
|
|
13f48e04df | ||
|
|
fa0d5e0765 | ||
|
|
86443d924d | ||
|
|
0440abbc91 | ||
|
|
143991124c | ||
|
|
55e670033b | ||
|
|
589fe49232 | ||
|
|
511c9a5ded |
+2
-4
@@ -1,9 +1,7 @@
|
||||
FROM golang:1.20.6-alpine3.18 as builder
|
||||
FROM golang:1.21.0-alpine3.18 as builder
|
||||
MAINTAINER xtaci <daniel820313@gmail.com>
|
||||
ENV GO111MODULE=on
|
||||
RUN apk update && \
|
||||
apk upgrade && \
|
||||
apk add git gcc libc-dev linux-headers
|
||||
RUN apk add git
|
||||
RUN git clone https://github.com/xtaci/kcptun.git
|
||||
RUN cd kcptun && \
|
||||
go build -mod=vendor -ldflags "-X main.VERSION=$(date -u +%Y%m%d) -s -w" -o /client github.com/xtaci/kcptun/client && \
|
||||
|
||||
@@ -37,6 +37,7 @@ type Config struct {
|
||||
SnmpPeriod int `json:"snmpperiod"`
|
||||
Quiet bool `json:"quiet"`
|
||||
TCP bool `json:"tcp"`
|
||||
Pprof bool `json:"pprof"`
|
||||
}
|
||||
|
||||
func parseJSONConfig(config *Config, path string) error {
|
||||
|
||||
+2525
File diff suppressed because one or more lines are too long
@@ -7,6 +7,8 @@ import (
|
||||
"log"
|
||||
"math/rand"
|
||||
"net"
|
||||
"net/http"
|
||||
_ "net/http/pprof"
|
||||
"os"
|
||||
"time"
|
||||
|
||||
@@ -243,6 +245,10 @@ func main() {
|
||||
Value: "", // when the value is not empty, the config path must exists
|
||||
Usage: "config from json file, which will override the command from shell",
|
||||
},
|
||||
cli.BoolFlag{
|
||||
Name: "pprof",
|
||||
Usage: "start profiling server on :6060",
|
||||
},
|
||||
}
|
||||
myApp.Action = func(c *cli.Context) error {
|
||||
config := Config{}
|
||||
@@ -276,6 +282,7 @@ func main() {
|
||||
config.SnmpPeriod = c.Int("snmpperiod")
|
||||
config.Quiet = c.Bool("quiet")
|
||||
config.TCP = c.Bool("tcp")
|
||||
config.Pprof = c.Bool("pprof")
|
||||
|
||||
if c.String("c") != "" {
|
||||
err := parseJSONConfig(&config, c.String("c"))
|
||||
@@ -341,6 +348,7 @@ func main() {
|
||||
log.Println("snmpperiod:", config.SnmpPeriod)
|
||||
log.Println("quiet:", config.Quiet)
|
||||
log.Println("tcp:", config.TCP)
|
||||
log.Println("pprof:", config.Pprof)
|
||||
|
||||
// parameters check
|
||||
if config.SmuxVer > maxSmuxVer {
|
||||
@@ -443,6 +451,11 @@ func main() {
|
||||
// start snmp logger
|
||||
go generic.SnmpLogger(config.SnmpLog, config.SnmpPeriod)
|
||||
|
||||
// start pprof
|
||||
if config.Pprof {
|
||||
go http.ListenAndServe(":6060", nil)
|
||||
}
|
||||
|
||||
// start scavenger
|
||||
chScavenger := make(chan timedSession, 128)
|
||||
go scavenger(chScavenger, &config)
|
||||
|
||||
@@ -3,25 +3,27 @@ module github.com/xtaci/kcptun
|
||||
require (
|
||||
github.com/golang/snappy v0.0.4
|
||||
github.com/pkg/errors v0.9.1
|
||||
github.com/urfave/cli v1.22.12
|
||||
github.com/xtaci/kcp-go/v5 v5.6.2
|
||||
github.com/urfave/cli v1.22.14
|
||||
github.com/xtaci/kcp-go/v5 v5.6.7
|
||||
github.com/xtaci/smux v1.5.24
|
||||
github.com/xtaci/tcpraw v1.2.25
|
||||
golang.org/x/crypto v0.5.0
|
||||
golang.org/x/crypto v0.17.0
|
||||
)
|
||||
|
||||
require (
|
||||
github.com/coreos/go-iptables v0.6.0 // indirect
|
||||
github.com/coreos/go-iptables v0.7.0 // indirect
|
||||
github.com/cpuguy83/go-md2man/v2 v2.0.2 // indirect
|
||||
github.com/google/gopacket v1.1.19 // indirect
|
||||
github.com/klauspost/cpuid/v2 v2.2.3 // indirect
|
||||
github.com/klauspost/reedsolomon v1.11.6 // indirect
|
||||
github.com/klauspost/cpuid/v2 v2.2.6 // indirect
|
||||
github.com/klauspost/reedsolomon v1.12.0 // indirect
|
||||
github.com/russross/blackfriday/v2 v2.1.0 // indirect
|
||||
github.com/templexxx/cpu v0.1.0 // indirect
|
||||
github.com/templexxx/xorsimd v0.4.2 // indirect
|
||||
github.com/tjfoc/gmsm v1.4.1 // indirect
|
||||
golang.org/x/net v0.7.0 // indirect
|
||||
golang.org/x/sys v0.5.0 // indirect
|
||||
golang.org/x/net v0.19.0 // indirect
|
||||
golang.org/x/sys v0.16.0 // indirect
|
||||
)
|
||||
|
||||
go 1.17
|
||||
go 1.21
|
||||
|
||||
toolchain go1.21.0
|
||||
|
||||
@@ -1,11 +1,11 @@
|
||||
cloud.google.com/go v0.26.0/go.mod h1:aQUYkXzVsufM+DwF1aE+0xfcU+56JwCaLick0ClmMTw=
|
||||
github.com/BurntSushi/toml v0.3.1/go.mod h1:xHWCNGjB5oqiDr8zfno3MHue2Ht5sIBksp03qcyfWMU=
|
||||
github.com/BurntSushi/toml v1.2.1/go.mod h1:CxXYINrC8qIiEnFrOxCa7Jy5BFHlXnUU2pbicEuybxQ=
|
||||
github.com/BurntSushi/toml v1.3.2/go.mod h1:CxXYINrC8qIiEnFrOxCa7Jy5BFHlXnUU2pbicEuybxQ=
|
||||
github.com/census-instrumentation/opencensus-proto v0.2.1/go.mod h1:f6KPmirojxKA12rnyqOA5BBL4O983OfeGPqjHWSTneU=
|
||||
github.com/client9/misspell v0.3.4/go.mod h1:qj6jICC3Q7zFZvVWo7KLAzC3yx5G7kyvSDkc90ppPyw=
|
||||
github.com/cncf/udpa/go v0.0.0-20191209042840-269d4d468f6f/go.mod h1:M8M6+tZqaGXZJjfX53e64911xZQV5JYwmTeXPW+k8Sc=
|
||||
github.com/coreos/go-iptables v0.6.0 h1:is9qnZMPYjLd8LYqmm/qlE+wwEgJIkTYdhV3rfZo4jk=
|
||||
github.com/coreos/go-iptables v0.6.0/go.mod h1:Qe8Bv2Xik5FyTXwgIbLAnv2sWSBmvWdFETJConOQ//Q=
|
||||
github.com/coreos/go-iptables v0.7.0 h1:XWM3V+MPRr5/q51NuWSgU0fqMad64Zyxs8ZUoMsamr8=
|
||||
github.com/coreos/go-iptables v0.7.0/go.mod h1:Qe8Bv2Xik5FyTXwgIbLAnv2sWSBmvWdFETJConOQ//Q=
|
||||
github.com/cpuguy83/go-md2man/v2 v2.0.2 h1:p1EgwI/C7NhT0JmVkwCD2ZBK8j4aeHQX2pMHHBfMQ6w=
|
||||
github.com/cpuguy83/go-md2man/v2 v2.0.2/go.mod h1:tgQtvFlXSQOSOSIRvRPT7W67SCa46tRHOmNcaadrF8o=
|
||||
github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
|
||||
@@ -33,13 +33,10 @@ github.com/google/go-cmp v0.3.1/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMyw
|
||||
github.com/google/go-cmp v0.4.0/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE=
|
||||
github.com/google/gopacket v1.1.19 h1:ves8RnFZPGiFnTS0uPQStjwru6uO6h+nlr9j6fL7kF8=
|
||||
github.com/google/gopacket v1.1.19/go.mod h1:iJ8V8n6KS+z2U1A8pUwu8bW5SyEMkXJB8Yo/Vo+TKTo=
|
||||
github.com/klauspost/cpuid/v2 v2.0.14/go.mod h1:g2LTdtYhdyuGPqyWyv7qRAmj1WBqxuObKfj5c0PQa7c=
|
||||
github.com/klauspost/cpuid/v2 v2.1.1/go.mod h1:RVVoqg1df56z8g3pUjL/3lE5UfnlrJX8tyFgg4nqhuY=
|
||||
github.com/klauspost/cpuid/v2 v2.2.3 h1:sxCkb+qR91z4vsqw4vGGZlDgPz3G7gjaLyK3V8y70BU=
|
||||
github.com/klauspost/cpuid/v2 v2.2.3/go.mod h1:RVVoqg1df56z8g3pUjL/3lE5UfnlrJX8tyFgg4nqhuY=
|
||||
github.com/klauspost/reedsolomon v1.10.0/go.mod h1:qHMIzMkuZUWqIh8mS/GruPdo3u0qwX2jk/LH440ON7Y=
|
||||
github.com/klauspost/reedsolomon v1.11.6 h1:h0MUpEzmretucmlelC3EefQHKgk6vWpKz/ctB/tmaEs=
|
||||
github.com/klauspost/reedsolomon v1.11.6/go.mod h1:cuXqklb3LNaurR5MVjy7WLXAEUqGz4I0Uc+rnQ7POUg=
|
||||
github.com/klauspost/cpuid/v2 v2.2.6 h1:ndNyv040zDGIDh8thGkXYjnFtiN02M1PVVF+JE/48xc=
|
||||
github.com/klauspost/cpuid/v2 v2.2.6/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws=
|
||||
github.com/klauspost/reedsolomon v1.12.0 h1:I5FEp3xSwVCcEh3F5A7dofEfhXdF/bWhQWPH+XwBFno=
|
||||
github.com/klauspost/reedsolomon v1.12.0/go.mod h1:EPLZJeh4l27pUGC3aXOjheaoh1I9yut7xTURiW3LQ9Y=
|
||||
github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4=
|
||||
github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0=
|
||||
github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
|
||||
@@ -50,46 +47,40 @@ github.com/russross/blackfriday/v2 v2.1.0/go.mod h1:+Rmxgy9KzJVeS9/2gXHxylqXiyQD
|
||||
github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME=
|
||||
github.com/stretchr/objx v0.4.0/go.mod h1:YvHI0jy2hoMjB+UWwv71VJQ9isScKT/TqJzVSSt89Yw=
|
||||
github.com/stretchr/objx v0.5.0/go.mod h1:Yh+to48EsGEfYuaHDzXPcE3xhTkx73EhmCGUpEOglKo=
|
||||
github.com/stretchr/testify v1.6.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg=
|
||||
github.com/stretchr/testify v1.7.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg=
|
||||
github.com/stretchr/testify v1.8.0/go.mod h1:yNjHg4UonilssWZ8iaSj1OCr/vHnekPRkoO+kdMU+MU=
|
||||
github.com/stretchr/testify v1.8.1 h1:w7B6lhMri9wdJUVmEZPGGhZzrYTPvgJArz7wNPgYKsk=
|
||||
github.com/stretchr/testify v1.8.1/go.mod h1:w2LPCIKwWwSfY2zedu0+kehJoqGctiVI29o6fzry7u4=
|
||||
github.com/templexxx/cpu v0.0.1/go.mod h1:w7Tb+7qgcAlIyX4NhLuDKt78AHA5SzPmq0Wj6HiEnnk=
|
||||
github.com/templexxx/cpu v0.0.9/go.mod h1:w7Tb+7qgcAlIyX4NhLuDKt78AHA5SzPmq0Wj6HiEnnk=
|
||||
github.com/stretchr/testify v1.8.4 h1:CcVxjf3Q8PM0mHUKJCdn+eZZtm5yQwehR5yeSVQQcUk=
|
||||
github.com/stretchr/testify v1.8.4/go.mod h1:sz/lmYIOXD/1dqDmKjjqLyZ2RngseejIcXlSw2iwfAo=
|
||||
github.com/templexxx/cpu v0.1.0 h1:wVM+WIJP2nYaxVxqgHPD4wGA2aJ9rvrQRV8CvFzNb40=
|
||||
github.com/templexxx/cpu v0.1.0/go.mod h1:w7Tb+7qgcAlIyX4NhLuDKt78AHA5SzPmq0Wj6HiEnnk=
|
||||
github.com/templexxx/xorsimd v0.4.1/go.mod h1:W+ffZz8jJMH2SXwuKu9WhygqBMbFnp14G2fqEr8qaNo=
|
||||
github.com/templexxx/xorsimd v0.4.2 h1:ocZZ+Nvu65LGHmCLZ7OoCtg8Fx8jnHKK37SjvngUoVI=
|
||||
github.com/templexxx/xorsimd v0.4.2/go.mod h1:HgwaPoDREdi6OnULpSfxhzaiiSUY4Fi3JPn1wpt28NI=
|
||||
github.com/tjfoc/gmsm v1.4.1 h1:aMe1GlZb+0bLjn+cKTPEvvn9oUEBlJitaZiiBwsbgho=
|
||||
github.com/tjfoc/gmsm v1.4.1/go.mod h1:j4INPkHWMrhJb38G+J6W4Tw0AbuN8Thu3PbdVYhVcTE=
|
||||
github.com/urfave/cli v1.22.12 h1:igJgVw1JdKH+trcLWLeLwZjU9fEfPesQ+9/e4MQ44S8=
|
||||
github.com/urfave/cli v1.22.12/go.mod h1:sSBEIC79qR6OvcmsD4U3KABeOTxDqQtdDnaFuUN30b8=
|
||||
github.com/xtaci/kcp-go/v5 v5.6.2 h1:pSXMa5MOsb+EIZKe4sDBqlTExu2A/2Z+DFhoX2qtt2A=
|
||||
github.com/xtaci/kcp-go/v5 v5.6.2/go.mod h1:LsinWoru+lWWJHb+EM9HeuqYxV6bb9rNcK12v67jYzQ=
|
||||
github.com/urfave/cli v1.22.14 h1:ebbhrRiGK2i4naQJr+1Xj92HXZCrK7MsyTS/ob3HnAk=
|
||||
github.com/urfave/cli v1.22.14/go.mod h1:X0eDS6pD6Exaclxm99NJ3FiCDRED7vIHpx2mDOHLvkA=
|
||||
github.com/xtaci/kcp-go/v5 v5.6.6 h1:SxSjZoaaLzQKxbIfzE1FYLMKtR2veox5mvKO7AliZ5I=
|
||||
github.com/xtaci/kcp-go/v5 v5.6.6/go.mod h1:oE9j2NVqAkuKO5o8ByKGch3vgVX3BNf8zqP8JiGq0bM=
|
||||
github.com/xtaci/kcp-go/v5 v5.6.7 h1:7+rnxNFIsjEwTXQk4cSZpXM4pO0hqtpwE1UFFoJBffA=
|
||||
github.com/xtaci/kcp-go/v5 v5.6.7/go.mod h1:oE9j2NVqAkuKO5o8ByKGch3vgVX3BNf8zqP8JiGq0bM=
|
||||
github.com/xtaci/lossyconn v0.0.0-20190602105132-8df528c0c9ae h1:J0GxkO96kL4WF+AIT3M4mfUVinOCPgf2uUWYFUzN0sM=
|
||||
github.com/xtaci/lossyconn v0.0.0-20190602105132-8df528c0c9ae/go.mod h1:gXtu8J62kEgmN++bm9BVICuT/e8yiLI2KFobd/TRFsE=
|
||||
github.com/xtaci/smux v1.5.24 h1:77emW9dtnOxxOQ5ltR+8BbsX1kzcOxQ5gB+aaV9hXOY=
|
||||
github.com/xtaci/smux v1.5.24/go.mod h1:OMlQbT5vcgl2gb49mFkYo6SMf+zP3rcjcwQz7ZU7IGY=
|
||||
github.com/xtaci/tcpraw v1.2.25 h1:VDlqo0op17JeXBM6e2G9ocCNLOJcw9mZbobMbJjo0vk=
|
||||
github.com/xtaci/tcpraw v1.2.25/go.mod h1:dKyZ2V75s0cZ7cbgJYdxPvms7af0joIeOyx1GgJQbLk=
|
||||
github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY=
|
||||
golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w=
|
||||
golang.org/x/crypto v0.0.0-20191011191535-87dc89f01550/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI=
|
||||
golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto=
|
||||
golang.org/x/crypto v0.0.0-20201012173705-84dcc777aaee/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto=
|
||||
golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc=
|
||||
golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4=
|
||||
golang.org/x/crypto v0.5.0 h1:U/0M97KRkSFvyD/3FSmdP5W5swImpNgle/EHFhOsQPE=
|
||||
golang.org/x/crypto v0.5.0/go.mod h1:NK/OQwhpMQP3MwtdjgLlYHnH9ebylxKWv3e0fK+mkQU=
|
||||
golang.org/x/crypto v0.17.0 h1:r8bRNjWL3GshPW3gkd+RpvzWrZAwPS49OmTGZ/uhM4k=
|
||||
golang.org/x/crypto v0.17.0/go.mod h1:gCAAfMLgwOJRpTjQ2zCCt2OcSfYMTeZVSRtQlPC7Nq4=
|
||||
golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA=
|
||||
golang.org/x/lint v0.0.0-20181026193005-c67002cb31c3/go.mod h1:UVdnD1Gm6xHRNCYTkRU2/jEulfH38KcIWyp/GAMgvoE=
|
||||
golang.org/x/lint v0.0.0-20190227174305-5b3e6a55c961/go.mod h1:wehouNa3lNwaWXcvxsM5YxQ5yQlVC4a0KAMCusXpPoU=
|
||||
golang.org/x/lint v0.0.0-20190313153728-d0100b6bd8b3/go.mod h1:6SW0HCj/g11FgYtHlgUYUwCkIfeOF89ocIRzGO/8vkc=
|
||||
golang.org/x/lint v0.0.0-20200302205851-738671d3881b/go.mod h1:3xt1FjdF8hUf6vQPIChWIBhFzV8gjjsPE/fR3IyQdNY=
|
||||
golang.org/x/mod v0.1.1-0.20191105210325-c90efee705ee/go.mod h1:QqPTAvyqsEbceGzBzNggFXnrqF1CaUcvgkdR5Ot7KZg=
|
||||
golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4=
|
||||
golang.org/x/net v0.0.0-20180724234803-3673e40ba225/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4=
|
||||
golang.org/x/net v0.0.0-20180826012351-8a410e7b638d/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4=
|
||||
golang.org/x/net v0.0.0-20190213061140-3a22650c66bd/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4=
|
||||
@@ -97,51 +88,27 @@ golang.org/x/net v0.0.0-20190311183353-d8887717615a/go.mod h1:t9HGtf8HONx5eT2rtn
|
||||
golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg=
|
||||
golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
|
||||
golang.org/x/net v0.0.0-20201010224723-4f7140c49acb/go.mod h1:sp8m0HH+o8qH0wwXwYZr8TS3Oi6o0r6Gce1SSxlDquU=
|
||||
golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg=
|
||||
golang.org/x/net v0.0.0-20211112202133-69e39bad7dc2/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y=
|
||||
golang.org/x/net v0.0.0-20220624214902-1bab6f366d9e/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c=
|
||||
golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c=
|
||||
golang.org/x/net v0.5.0/go.mod h1:DivGGAXEgPSlEBzxGzZI+ZLohi+xUj054jfeKui00ws=
|
||||
golang.org/x/net v0.7.0 h1:rJrUqqhjsgNp7KqAIc25s9pZnjU7TUcSY7HcVZjdn1g=
|
||||
golang.org/x/net v0.7.0/go.mod h1:2Tu9+aMcznHK/AK1HMvgo6xiTLG5rD5rZLDS+rp2Bjs=
|
||||
golang.org/x/net v0.19.0 h1:zTwKpTd2XuCqf8huc7Fo2iSy+4RHPd10s4KzeTnVr1c=
|
||||
golang.org/x/net v0.19.0/go.mod h1:CfAk/cbD4CthTvqiEl8NpboMuiuOYsAr/7NOjZJtv1U=
|
||||
golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U=
|
||||
golang.org/x/sync v0.0.0-20180314180146-1d60e4601c6f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
|
||||
golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
|
||||
golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
|
||||
golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
|
||||
golang.org/x/sys v0.0.0-20180830151530-49385e6e1522/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
|
||||
golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
|
||||
golang.org/x/sys v0.0.0-20190412213103-97732733099d/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
|
||||
golang.org/x/sys v0.0.0-20200930185726-fdedc70b468f/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
|
||||
golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
|
||||
golang.org/x/sys v0.0.0-20210423082822-04245dca01da/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
|
||||
golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
|
||||
golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
|
||||
golang.org/x/sys v0.0.0-20220624220833-87e55d714810/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
|
||||
golang.org/x/sys v0.0.0-20220704084225-05e143d24a9e/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
|
||||
golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
|
||||
golang.org/x/sys v0.4.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
|
||||
golang.org/x/sys v0.5.0 h1:MUK/U/4lj1t1oPg0HfuXDN/Z1wv31ZJ/YcPiGccS4DU=
|
||||
golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
|
||||
golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
|
||||
golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8=
|
||||
golang.org/x/term v0.4.0/go.mod h1:9P2UbLfCdcvo3p/nzKvsmas4TnlujnuoV9hGgYzW1lQ=
|
||||
golang.org/x/term v0.5.0/go.mod h1:jMB1sMXY+tzblOD4FWmEbocvup2/aLOaQEp7JmGp78k=
|
||||
golang.org/x/sys v0.16.0 h1:xWw16ngr6ZMtmxDyKyIgsE93KNKz5HKmMa3b8ALHidU=
|
||||
golang.org/x/sys v0.16.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
|
||||
golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
|
||||
golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
|
||||
golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
|
||||
golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ=
|
||||
golang.org/x/text v0.6.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8=
|
||||
golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8=
|
||||
golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
|
||||
golang.org/x/tools v0.0.0-20190114222345-bf090417da8b/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
|
||||
golang.org/x/tools v0.0.0-20190226205152-f727befe758c/go.mod h1:9Yl7xja0Znq3iFh3HoIrodX9oNMXvdceNzlUR8zjMvY=
|
||||
golang.org/x/tools v0.0.0-20190311212946-11955173bddd/go.mod h1:LCzVGOaR6xXOjkQ3onu1FJEFr0SW1gC7cKk1uF8kGRs=
|
||||
golang.org/x/tools v0.0.0-20190524140312-2c0ae7006135/go.mod h1:RgjU9mgBXZiqYHBnxXauZ1Gv1EHHAz9KjViQ78xBX0Q=
|
||||
golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
|
||||
golang.org/x/tools v0.0.0-20200130002326-2f3ba24bd6e7/go.mod h1:TB2adYChydJhpapKDTa4BR/hXlZSLoq2Wpct/0txZ28=
|
||||
golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc=
|
||||
golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
|
||||
golang.org/x/xerrors v0.0.0-20191011141410-1b5146add898/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
|
||||
golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
|
||||
google.golang.org/appengine v1.1.0/go.mod h1:EbEs0AVv82hx2wNQdGPgUI5lhzA/G0D9YwlJXL52JkM=
|
||||
|
||||
+42
-3
@@ -52,7 +52,8 @@ func (e *Error) IsNotExist() bool {
|
||||
}
|
||||
msgNoRuleExist := "Bad rule (does a matching rule exist in that chain?).\n"
|
||||
msgNoChainExist := "No chain/target/match by that name.\n"
|
||||
return strings.Contains(e.msg, msgNoRuleExist) || strings.Contains(e.msg, msgNoChainExist)
|
||||
msgENOENT := "No such file or directory"
|
||||
return strings.Contains(e.msg, msgNoRuleExist) || strings.Contains(e.msg, msgNoChainExist) || strings.Contains(e.msg, msgENOENT)
|
||||
}
|
||||
|
||||
// Protocol to differentiate between IPv4 and IPv6
|
||||
@@ -109,6 +110,7 @@ func Timeout(timeout int) option {
|
||||
// For backwards compatibility, by default always uses IPv4 and timeout 0.
|
||||
// i.e. you can create an IPv6 IPTables using a timeout of 5 seconds passing
|
||||
// the IPFamily and Timeout options as follow:
|
||||
//
|
||||
// ip6t := New(IPFamily(ProtocolIPv6), Timeout(5))
|
||||
func New(opts ...option) (*IPTables, error) {
|
||||
|
||||
@@ -185,6 +187,26 @@ func (ipt *IPTables) Insert(table, chain string, pos int, rulespec ...string) er
|
||||
return ipt.run(cmd...)
|
||||
}
|
||||
|
||||
// Replace replaces rulespec to specified table/chain (in specified pos)
|
||||
func (ipt *IPTables) Replace(table, chain string, pos int, rulespec ...string) error {
|
||||
cmd := append([]string{"-t", table, "-R", chain, strconv.Itoa(pos)}, rulespec...)
|
||||
return ipt.run(cmd...)
|
||||
}
|
||||
|
||||
// InsertUnique acts like Insert except that it won't insert a duplicate (no matter the position in the chain)
|
||||
func (ipt *IPTables) InsertUnique(table, chain string, pos int, rulespec ...string) error {
|
||||
exists, err := ipt.Exists(table, chain, rulespec...)
|
||||
if err != nil {
|
||||
return err
|
||||
}
|
||||
|
||||
if !exists {
|
||||
return ipt.Insert(table, chain, pos, rulespec...)
|
||||
}
|
||||
|
||||
return nil
|
||||
}
|
||||
|
||||
// Append appends rulespec to specified table/chain
|
||||
func (ipt *IPTables) Append(table, chain string, rulespec ...string) error {
|
||||
cmd := append([]string{"-t", table, "-A", chain}, rulespec...)
|
||||
@@ -219,6 +241,16 @@ func (ipt *IPTables) DeleteIfExists(table, chain string, rulespec ...string) err
|
||||
return err
|
||||
}
|
||||
|
||||
// List rules in specified table/chain
|
||||
func (ipt *IPTables) ListById(table, chain string, id int) (string, error) {
|
||||
args := []string{"-t", table, "-S", chain, strconv.Itoa(id)}
|
||||
rule, err := ipt.executeList(args)
|
||||
if err != nil {
|
||||
return "", err
|
||||
}
|
||||
return rule[0], nil
|
||||
}
|
||||
|
||||
// List rules in specified table/chain
|
||||
func (ipt *IPTables) List(table, chain string) ([]string, error) {
|
||||
args := []string{"-t", table, "-S", chain}
|
||||
@@ -291,6 +323,11 @@ func (ipt *IPTables) Stats(table, chain string) ([][]string, error) {
|
||||
|
||||
ipv6 := ipt.proto == ProtocolIPv6
|
||||
|
||||
// Skip the warning if exist
|
||||
if strings.HasPrefix(lines[0], "#") {
|
||||
lines = lines[1:]
|
||||
}
|
||||
|
||||
rows := [][]string{}
|
||||
for i, line := range lines {
|
||||
// Skip over chain name and field header
|
||||
@@ -510,7 +547,9 @@ func (ipt *IPTables) runWithOutput(args []string, stdout io.Writer) error {
|
||||
syscall.Close(fmu.fd)
|
||||
return err
|
||||
}
|
||||
defer ul.Unlock()
|
||||
defer func() {
|
||||
_ = ul.Unlock()
|
||||
}()
|
||||
}
|
||||
|
||||
var stderr bytes.Buffer
|
||||
@@ -619,7 +658,7 @@ func iptablesHasWaitCommand(v1 int, v2 int, v3 int) bool {
|
||||
return false
|
||||
}
|
||||
|
||||
//Checks if an iptablse version is after 1.6.0, when --wait support second
|
||||
// Checks if an iptablse version is after 1.6.0, when --wait support second
|
||||
func iptablesWaitSupportSecond(v1 int, v2 int, v3 int) bool {
|
||||
if v1 > 1 {
|
||||
return true
|
||||
|
||||
+22
-6
@@ -9,16 +9,19 @@ You can access the CPU information by accessing the shared CPU variable of the c
|
||||
Package home: https://github.com/klauspost/cpuid
|
||||
|
||||
[](https://pkg.go.dev/github.com/klauspost/cpuid/v2)
|
||||
[![Build Status][3]][4]
|
||||
|
||||
[3]: https://travis-ci.org/klauspost/cpuid.svg?branch=master
|
||||
[4]: https://travis-ci.org/klauspost/cpuid
|
||||
[](https://github.com/klauspost/cpuid/actions/workflows/go.yml)
|
||||
|
||||
## installing
|
||||
|
||||
`go get -u github.com/klauspost/cpuid/v2` using modules.
|
||||
Drop `v2` for others.
|
||||
|
||||
Installing binary:
|
||||
|
||||
`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
|
||||
|
||||
Or download binaries from release page: https://github.com/klauspost/cpuid/releases
|
||||
|
||||
### Homebrew
|
||||
|
||||
For macOS/Linux users, you can install via [brew](https://brew.sh/)
|
||||
@@ -279,7 +282,12 @@ Exit Code 1
|
||||
| AMXINT8 | Tile computational operations on 8-bit integers |
|
||||
| AMXFP16 | Tile computational operations on FP16 numbers |
|
||||
| AMXTILE | Tile architecture |
|
||||
| APX_F | Intel APX |
|
||||
| AVX | AVX functions |
|
||||
| AVX10 | If set the Intel AVX10 Converged Vector ISA is supported |
|
||||
| AVX10_128 | If set indicates that AVX10 128-bit vector support is present |
|
||||
| AVX10_256 | If set indicates that AVX10 256-bit vector support is present |
|
||||
| AVX10_512 | If set indicates that AVX10 512-bit vector support is present |
|
||||
| AVX2 | AVX2 functions |
|
||||
| AVX512BF16 | AVX-512 BFLOAT16 Instructions |
|
||||
| AVX512BITALG | AVX-512 Bit Algorithms |
|
||||
@@ -302,6 +310,7 @@ Exit Code 1
|
||||
| AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one |
|
||||
| AVXVNNI | AVX (VEX encoded) VNNI neural network instructions |
|
||||
| AVXVNNIINT8 | AVX-VNNI-INT8 instructions |
|
||||
| BHI_CTRL | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 |
|
||||
| BMI1 | Bit Manipulation Instruction Set 1 |
|
||||
| BMI2 | Bit Manipulation Instruction Set 2 |
|
||||
| CETIBT | Intel CET Indirect Branch Tracking |
|
||||
@@ -355,8 +364,11 @@ Exit Code 1
|
||||
| IBS_OPFUSE | AMD: Indicates support for IbsOpFuse |
|
||||
| IBS_PREVENTHOST | Disallowing IBS use by the host supported |
|
||||
| IBS_ZEN4 | Fetch and Op IBS support IBS extensions added with Zen4 |
|
||||
| IDPRED_CTRL | IPRED_DIS |
|
||||
| INT_WBINVD | WBINVD/WBNOINVD are interruptible. |
|
||||
| INVLPGB | NVLPGB and TLBSYNC instruction supported |
|
||||
| KEYLOCKER | Key locker |
|
||||
| KEYLOCKERW | Key locker wide |
|
||||
| LAHF | LAHF/SAHF in long mode |
|
||||
| LAM | If set, CPU supports Linear Address Masking |
|
||||
| LBRVIRT | LBR virtualization |
|
||||
@@ -374,6 +386,7 @@ Exit Code 1
|
||||
| MPX | Intel MPX (Memory Protection Extensions) |
|
||||
| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD |
|
||||
| MSRIRC | Instruction Retired Counter MSR available |
|
||||
| MSRLIST | Read/Write List of Model Specific Registers |
|
||||
| MSR_PAGEFLUSH | Page Flush MSR available |
|
||||
| NRIPS | Indicates support for NRIP save on VMEXIT |
|
||||
| NX | NX (No-Execute) bit |
|
||||
@@ -381,12 +394,13 @@ Exit Code 1
|
||||
| PCONFIG | PCONFIG for Intel Multi-Key Total Memory Encryption |
|
||||
| POPCNT | POPCNT instruction |
|
||||
| PPIN | AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled |
|
||||
| PREFETCHI | PREFETCHIT0/1 instructions |
|
||||
| PSFD | AMD: Predictive Store Forward Disable |
|
||||
| PREFETCHI | PREFETCHIT0/1 instructions |
|
||||
| PSFD | Predictive Store Forward Disable |
|
||||
| RDPRU | RDPRU instruction supported |
|
||||
| RDRAND | RDRAND instruction is available |
|
||||
| RDSEED | RDSEED instruction is available |
|
||||
| RDTSCP | RDTSCP Instruction |
|
||||
| RRSBA_CTRL | Restricted RSB Alternate |
|
||||
| RTM | Restricted Transactional Memory |
|
||||
| RTM_ALWAYS_ABORT | Indicates that the loaded microcode is forcing RTM abort. |
|
||||
| SERIALIZE | Serialize Instruction Execution |
|
||||
@@ -425,6 +439,7 @@ Exit Code 1
|
||||
| SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. |
|
||||
| SYSEE | SYSENTER and SYSEXIT instructions |
|
||||
| TBM | AMD Trailing Bit Manipulation |
|
||||
| TDX_GUEST | Intel Trust Domain Extensions Guest |
|
||||
| TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations |
|
||||
| TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. |
|
||||
| TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. |
|
||||
@@ -439,6 +454,7 @@ Exit Code 1
|
||||
| VTE | AMD Virtual Transparent Encryption supported |
|
||||
| WAITPKG | TPAUSE, UMONITOR, UMWAIT |
|
||||
| WBNOINVD | Write Back and Do Not Invalidate Cache |
|
||||
| WRMSRNS | Non-Serializing Write to Model Specific Register |
|
||||
| X87 | FPU |
|
||||
| XGETBV1 | Supports XGETBV with ECX = 1 |
|
||||
| XOP | Bulldozer XOP functions |
|
||||
|
||||
+76
-10
@@ -76,7 +76,12 @@ const (
|
||||
AMXFP16 // Tile computational operations on FP16 numbers
|
||||
AMXINT8 // Tile computational operations on 8-bit integers
|
||||
AMXTILE // Tile architecture
|
||||
APX_F // Intel APX
|
||||
AVX // AVX functions
|
||||
AVX10 // If set the Intel AVX10 Converged Vector ISA is supported
|
||||
AVX10_128 // If set indicates that AVX10 128-bit vector support is present
|
||||
AVX10_256 // If set indicates that AVX10 256-bit vector support is present
|
||||
AVX10_512 // If set indicates that AVX10 512-bit vector support is present
|
||||
AVX2 // AVX2 functions
|
||||
AVX512BF16 // AVX-512 BFLOAT16 Instructions
|
||||
AVX512BITALG // AVX-512 Bit Algorithms
|
||||
@@ -99,6 +104,7 @@ const (
|
||||
AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one
|
||||
AVXVNNI // AVX (VEX encoded) VNNI neural network instructions
|
||||
AVXVNNIINT8 // AVX-VNNI-INT8 instructions
|
||||
BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598
|
||||
BMI1 // Bit Manipulation Instruction Set 1
|
||||
BMI2 // Bit Manipulation Instruction Set 2
|
||||
CETIBT // Intel CET Indirect Branch Tracking
|
||||
@@ -152,8 +158,11 @@ const (
|
||||
IBS_OPFUSE // AMD: Indicates support for IbsOpFuse
|
||||
IBS_PREVENTHOST // Disallowing IBS use by the host supported
|
||||
IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4
|
||||
IDPRED_CTRL // IPRED_DIS
|
||||
INT_WBINVD // WBINVD/WBNOINVD are interruptible.
|
||||
INVLPGB // NVLPGB and TLBSYNC instruction supported
|
||||
KEYLOCKER // Key locker
|
||||
KEYLOCKERW // Key locker wide
|
||||
LAHF // LAHF/SAHF in long mode
|
||||
LAM // If set, CPU supports Linear Address Masking
|
||||
LBRVIRT // LBR virtualization
|
||||
@@ -171,6 +180,7 @@ const (
|
||||
MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD
|
||||
MPX // Intel MPX (Memory Protection Extensions)
|
||||
MSRIRC // Instruction Retired Counter MSR available
|
||||
MSRLIST // Read/Write List of Model Specific Registers
|
||||
MSR_PAGEFLUSH // Page Flush MSR available
|
||||
NRIPS // Indicates support for NRIP save on VMEXIT
|
||||
NX // NX (No-Execute) bit
|
||||
@@ -179,11 +189,12 @@ const (
|
||||
POPCNT // POPCNT instruction
|
||||
PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled
|
||||
PREFETCHI // PREFETCHIT0/1 instructions
|
||||
PSFD // AMD: Predictive Store Forward Disable
|
||||
PSFD // Predictive Store Forward Disable
|
||||
RDPRU // RDPRU instruction supported
|
||||
RDRAND // RDRAND instruction is available
|
||||
RDSEED // RDSEED instruction is available
|
||||
RDTSCP // RDTSCP Instruction
|
||||
RRSBA_CTRL // Restricted RSB Alternate
|
||||
RTM // Restricted Transactional Memory
|
||||
RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort.
|
||||
SERIALIZE // Serialize Instruction Execution
|
||||
@@ -222,6 +233,7 @@ const (
|
||||
SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions.
|
||||
SYSEE // SYSENTER and SYSEXIT instructions
|
||||
TBM // AMD Trailing Bit Manipulation
|
||||
TDX_GUEST // Intel Trust Domain Extensions Guest
|
||||
TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations
|
||||
TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE.
|
||||
TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX.
|
||||
@@ -236,6 +248,7 @@ const (
|
||||
VTE // AMD Virtual Transparent Encryption supported
|
||||
WAITPKG // TPAUSE, UMONITOR, UMWAIT
|
||||
WBNOINVD // Write Back and Do Not Invalidate Cache
|
||||
WRMSRNS // Non-Serializing Write to Model Specific Register
|
||||
X87 // FPU
|
||||
XGETBV1 // Supports XGETBV with ECX = 1
|
||||
XOP // Bulldozer XOP functions
|
||||
@@ -296,9 +309,10 @@ type CPUInfo struct {
|
||||
L2 int // L2 Cache (per core or shared). Will be -1 if undetected
|
||||
L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected
|
||||
}
|
||||
SGX SGXSupport
|
||||
maxFunc uint32
|
||||
maxExFunc uint32
|
||||
SGX SGXSupport
|
||||
AVX10Level uint8
|
||||
maxFunc uint32
|
||||
maxExFunc uint32
|
||||
}
|
||||
|
||||
var cpuid func(op uint32) (eax, ebx, ecx, edx uint32)
|
||||
@@ -1159,6 +1173,7 @@ func support() flagSet {
|
||||
fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ)
|
||||
fs.setIf(ecx&(1<<13) != 0, TME)
|
||||
fs.setIf(ecx&(1<<25) != 0, CLDEMOTE)
|
||||
fs.setIf(ecx&(1<<23) != 0, KEYLOCKER)
|
||||
fs.setIf(ecx&(1<<27) != 0, MOVDIRI)
|
||||
fs.setIf(ecx&(1<<28) != 0, MOVDIR64B)
|
||||
fs.setIf(ecx&(1<<29) != 0, ENQCMD)
|
||||
@@ -1181,13 +1196,8 @@ func support() flagSet {
|
||||
fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP)
|
||||
fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD)
|
||||
|
||||
// CPUID.(EAX=7, ECX=1).EDX
|
||||
fs.setIf(edx&(1<<4) != 0, AVXVNNIINT8)
|
||||
fs.setIf(edx&(1<<5) != 0, AVXNECONVERT)
|
||||
fs.setIf(edx&(1<<14) != 0, PREFETCHI)
|
||||
|
||||
// CPUID.(EAX=7, ECX=1).EAX
|
||||
eax1, _, _, _ := cpuidex(7, 1)
|
||||
eax1, _, _, edx1 := cpuidex(7, 1)
|
||||
fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI)
|
||||
fs.setIf(eax1&(1<<7) != 0, CMPCCXADD)
|
||||
fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL)
|
||||
@@ -1197,6 +1207,13 @@ func support() flagSet {
|
||||
fs.setIf(eax1&(1<<23) != 0, AVXIFMA)
|
||||
fs.setIf(eax1&(1<<26) != 0, LAM)
|
||||
|
||||
// CPUID.(EAX=7, ECX=1).EDX
|
||||
fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
|
||||
fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
|
||||
fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
|
||||
fs.setIf(edx1&(1<<19) != 0, AVX10)
|
||||
fs.setIf(edx1&(1<<21) != 0, APX_F)
|
||||
|
||||
// Only detect AVX-512 features if XGETBV is supported
|
||||
if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) {
|
||||
// Check for OS support
|
||||
@@ -1232,13 +1249,33 @@ func support() flagSet {
|
||||
fs.setIf(edx&(1<<25) != 0, AMXINT8)
|
||||
// eax1 = CPUID.(EAX=7, ECX=1).EAX
|
||||
fs.setIf(eax1&(1<<5) != 0, AVX512BF16)
|
||||
fs.setIf(eax1&(1<<19) != 0, WRMSRNS)
|
||||
fs.setIf(eax1&(1<<21) != 0, AMXFP16)
|
||||
fs.setIf(eax1&(1<<27) != 0, MSRLIST)
|
||||
}
|
||||
}
|
||||
|
||||
// CPUID.(EAX=7, ECX=2)
|
||||
_, _, _, edx = cpuidex(7, 2)
|
||||
fs.setIf(edx&(1<<0) != 0, PSFD)
|
||||
fs.setIf(edx&(1<<1) != 0, IDPRED_CTRL)
|
||||
fs.setIf(edx&(1<<2) != 0, RRSBA_CTRL)
|
||||
fs.setIf(edx&(1<<4) != 0, BHI_CTRL)
|
||||
fs.setIf(edx&(1<<5) != 0, MCDT_NO)
|
||||
|
||||
// Add keylocker features.
|
||||
if fs.inSet(KEYLOCKER) && mfi >= 0x19 {
|
||||
_, ebx, _, _ := cpuidex(0x19, 0)
|
||||
fs.setIf(ebx&5 == 5, KEYLOCKERW) // Bit 0 and 2 (1+4)
|
||||
}
|
||||
|
||||
// Add AVX10 features.
|
||||
if fs.inSet(AVX10) && mfi >= 0x24 {
|
||||
_, ebx, _, _ := cpuidex(0x24, 0)
|
||||
fs.setIf(ebx&(1<<16) != 0, AVX10_128)
|
||||
fs.setIf(ebx&(1<<17) != 0, AVX10_256)
|
||||
fs.setIf(ebx&(1<<18) != 0, AVX10_512)
|
||||
}
|
||||
}
|
||||
|
||||
// Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1)
|
||||
@@ -1381,9 +1418,38 @@ func support() flagSet {
|
||||
fs.setIf((a>>24)&1 == 1, VMSA_REGPROT)
|
||||
}
|
||||
|
||||
if mfi >= 0x20 {
|
||||
// Microsoft has decided to purposefully hide the information
|
||||
// of the guest TEE when VMs are being created using Hyper-V.
|
||||
//
|
||||
// This leads us to check for the Hyper-V cpuid features
|
||||
// (0x4000000C), and then for the `ebx` value set.
|
||||
//
|
||||
// For Intel TDX, `ebx` is set as `0xbe3`, being 3 the part
|
||||
// we're mostly interested about,according to:
|
||||
// https://github.com/torvalds/linux/blob/d2f51b3516dade79269ff45eae2a7668ae711b25/arch/x86/include/asm/hyperv-tlfs.h#L169-L174
|
||||
_, ebx, _, _ := cpuid(0x4000000C)
|
||||
fs.setIf(ebx == 0xbe3, TDX_GUEST)
|
||||
}
|
||||
|
||||
if mfi >= 0x21 {
|
||||
// Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21).
|
||||
_, ebx, ecx, edx := cpuid(0x21)
|
||||
identity := string(valAsString(ebx, edx, ecx))
|
||||
fs.setIf(identity == "IntelTDX ", TDX_GUEST)
|
||||
}
|
||||
|
||||
return fs
|
||||
}
|
||||
|
||||
func (c *CPUInfo) supportAVX10() uint8 {
|
||||
if c.maxFunc >= 0x24 && c.featureSet.inSet(AVX10) {
|
||||
_, ebx, _, _ := cpuidex(0x24, 0)
|
||||
return uint8(ebx)
|
||||
}
|
||||
return 0
|
||||
}
|
||||
|
||||
func valAsString(values ...uint32) []byte {
|
||||
r := make([]byte, 4*len(values))
|
||||
for i, v := range values {
|
||||
|
||||
+1
@@ -31,6 +31,7 @@ func addInfo(c *CPUInfo, safe bool) {
|
||||
c.LogicalCores = logicalCores()
|
||||
c.PhysicalCores = physicalCores()
|
||||
c.VendorID, c.VendorString = vendorID()
|
||||
c.AVX10Level = c.supportAVX10()
|
||||
c.cacheSize()
|
||||
c.frequencies()
|
||||
}
|
||||
|
||||
+207
-194
@@ -16,204 +16,217 @@ func _() {
|
||||
_ = x[AMXFP16-6]
|
||||
_ = x[AMXINT8-7]
|
||||
_ = x[AMXTILE-8]
|
||||
_ = x[AVX-9]
|
||||
_ = x[AVX2-10]
|
||||
_ = x[AVX512BF16-11]
|
||||
_ = x[AVX512BITALG-12]
|
||||
_ = x[AVX512BW-13]
|
||||
_ = x[AVX512CD-14]
|
||||
_ = x[AVX512DQ-15]
|
||||
_ = x[AVX512ER-16]
|
||||
_ = x[AVX512F-17]
|
||||
_ = x[AVX512FP16-18]
|
||||
_ = x[AVX512IFMA-19]
|
||||
_ = x[AVX512PF-20]
|
||||
_ = x[AVX512VBMI-21]
|
||||
_ = x[AVX512VBMI2-22]
|
||||
_ = x[AVX512VL-23]
|
||||
_ = x[AVX512VNNI-24]
|
||||
_ = x[AVX512VP2INTERSECT-25]
|
||||
_ = x[AVX512VPOPCNTDQ-26]
|
||||
_ = x[AVXIFMA-27]
|
||||
_ = x[AVXNECONVERT-28]
|
||||
_ = x[AVXSLOW-29]
|
||||
_ = x[AVXVNNI-30]
|
||||
_ = x[AVXVNNIINT8-31]
|
||||
_ = x[BMI1-32]
|
||||
_ = x[BMI2-33]
|
||||
_ = x[CETIBT-34]
|
||||
_ = x[CETSS-35]
|
||||
_ = x[CLDEMOTE-36]
|
||||
_ = x[CLMUL-37]
|
||||
_ = x[CLZERO-38]
|
||||
_ = x[CMOV-39]
|
||||
_ = x[CMPCCXADD-40]
|
||||
_ = x[CMPSB_SCADBS_SHORT-41]
|
||||
_ = x[CMPXCHG8-42]
|
||||
_ = x[CPBOOST-43]
|
||||
_ = x[CPPC-44]
|
||||
_ = x[CX16-45]
|
||||
_ = x[EFER_LMSLE_UNS-46]
|
||||
_ = x[ENQCMD-47]
|
||||
_ = x[ERMS-48]
|
||||
_ = x[F16C-49]
|
||||
_ = x[FLUSH_L1D-50]
|
||||
_ = x[FMA3-51]
|
||||
_ = x[FMA4-52]
|
||||
_ = x[FP128-53]
|
||||
_ = x[FP256-54]
|
||||
_ = x[FSRM-55]
|
||||
_ = x[FXSR-56]
|
||||
_ = x[FXSROPT-57]
|
||||
_ = x[GFNI-58]
|
||||
_ = x[HLE-59]
|
||||
_ = x[HRESET-60]
|
||||
_ = x[HTT-61]
|
||||
_ = x[HWA-62]
|
||||
_ = x[HYBRID_CPU-63]
|
||||
_ = x[HYPERVISOR-64]
|
||||
_ = x[IA32_ARCH_CAP-65]
|
||||
_ = x[IA32_CORE_CAP-66]
|
||||
_ = x[IBPB-67]
|
||||
_ = x[IBRS-68]
|
||||
_ = x[IBRS_PREFERRED-69]
|
||||
_ = x[IBRS_PROVIDES_SMP-70]
|
||||
_ = x[IBS-71]
|
||||
_ = x[IBSBRNTRGT-72]
|
||||
_ = x[IBSFETCHSAM-73]
|
||||
_ = x[IBSFFV-74]
|
||||
_ = x[IBSOPCNT-75]
|
||||
_ = x[IBSOPCNTEXT-76]
|
||||
_ = x[IBSOPSAM-77]
|
||||
_ = x[IBSRDWROPCNT-78]
|
||||
_ = x[IBSRIPINVALIDCHK-79]
|
||||
_ = x[IBS_FETCH_CTLX-80]
|
||||
_ = x[IBS_OPDATA4-81]
|
||||
_ = x[IBS_OPFUSE-82]
|
||||
_ = x[IBS_PREVENTHOST-83]
|
||||
_ = x[IBS_ZEN4-84]
|
||||
_ = x[INT_WBINVD-85]
|
||||
_ = x[INVLPGB-86]
|
||||
_ = x[LAHF-87]
|
||||
_ = x[LAM-88]
|
||||
_ = x[LBRVIRT-89]
|
||||
_ = x[LZCNT-90]
|
||||
_ = x[MCAOVERFLOW-91]
|
||||
_ = x[MCDT_NO-92]
|
||||
_ = x[MCOMMIT-93]
|
||||
_ = x[MD_CLEAR-94]
|
||||
_ = x[MMX-95]
|
||||
_ = x[MMXEXT-96]
|
||||
_ = x[MOVBE-97]
|
||||
_ = x[MOVDIR64B-98]
|
||||
_ = x[MOVDIRI-99]
|
||||
_ = x[MOVSB_ZL-100]
|
||||
_ = x[MOVU-101]
|
||||
_ = x[MPX-102]
|
||||
_ = x[MSRIRC-103]
|
||||
_ = x[MSR_PAGEFLUSH-104]
|
||||
_ = x[NRIPS-105]
|
||||
_ = x[NX-106]
|
||||
_ = x[OSXSAVE-107]
|
||||
_ = x[PCONFIG-108]
|
||||
_ = x[POPCNT-109]
|
||||
_ = x[PPIN-110]
|
||||
_ = x[PREFETCHI-111]
|
||||
_ = x[PSFD-112]
|
||||
_ = x[RDPRU-113]
|
||||
_ = x[RDRAND-114]
|
||||
_ = x[RDSEED-115]
|
||||
_ = x[RDTSCP-116]
|
||||
_ = x[RTM-117]
|
||||
_ = x[RTM_ALWAYS_ABORT-118]
|
||||
_ = x[SERIALIZE-119]
|
||||
_ = x[SEV-120]
|
||||
_ = x[SEV_64BIT-121]
|
||||
_ = x[SEV_ALTERNATIVE-122]
|
||||
_ = x[SEV_DEBUGSWAP-123]
|
||||
_ = x[SEV_ES-124]
|
||||
_ = x[SEV_RESTRICTED-125]
|
||||
_ = x[SEV_SNP-126]
|
||||
_ = x[SGX-127]
|
||||
_ = x[SGXLC-128]
|
||||
_ = x[SHA-129]
|
||||
_ = x[SME-130]
|
||||
_ = x[SME_COHERENT-131]
|
||||
_ = x[SPEC_CTRL_SSBD-132]
|
||||
_ = x[SRBDS_CTRL-133]
|
||||
_ = x[SSE-134]
|
||||
_ = x[SSE2-135]
|
||||
_ = x[SSE3-136]
|
||||
_ = x[SSE4-137]
|
||||
_ = x[SSE42-138]
|
||||
_ = x[SSE4A-139]
|
||||
_ = x[SSSE3-140]
|
||||
_ = x[STIBP-141]
|
||||
_ = x[STIBP_ALWAYSON-142]
|
||||
_ = x[STOSB_SHORT-143]
|
||||
_ = x[SUCCOR-144]
|
||||
_ = x[SVM-145]
|
||||
_ = x[SVMDA-146]
|
||||
_ = x[SVMFBASID-147]
|
||||
_ = x[SVML-148]
|
||||
_ = x[SVMNP-149]
|
||||
_ = x[SVMPF-150]
|
||||
_ = x[SVMPFT-151]
|
||||
_ = x[SYSCALL-152]
|
||||
_ = x[SYSEE-153]
|
||||
_ = x[TBM-154]
|
||||
_ = x[TLB_FLUSH_NESTED-155]
|
||||
_ = x[TME-156]
|
||||
_ = x[TOPEXT-157]
|
||||
_ = x[TSCRATEMSR-158]
|
||||
_ = x[TSXLDTRK-159]
|
||||
_ = x[VAES-160]
|
||||
_ = x[VMCBCLEAN-161]
|
||||
_ = x[VMPL-162]
|
||||
_ = x[VMSA_REGPROT-163]
|
||||
_ = x[VMX-164]
|
||||
_ = x[VPCLMULQDQ-165]
|
||||
_ = x[VTE-166]
|
||||
_ = x[WAITPKG-167]
|
||||
_ = x[WBNOINVD-168]
|
||||
_ = x[X87-169]
|
||||
_ = x[XGETBV1-170]
|
||||
_ = x[XOP-171]
|
||||
_ = x[XSAVE-172]
|
||||
_ = x[XSAVEC-173]
|
||||
_ = x[XSAVEOPT-174]
|
||||
_ = x[XSAVES-175]
|
||||
_ = x[AESARM-176]
|
||||
_ = x[ARMCPUID-177]
|
||||
_ = x[ASIMD-178]
|
||||
_ = x[ASIMDDP-179]
|
||||
_ = x[ASIMDHP-180]
|
||||
_ = x[ASIMDRDM-181]
|
||||
_ = x[ATOMICS-182]
|
||||
_ = x[CRC32-183]
|
||||
_ = x[DCPOP-184]
|
||||
_ = x[EVTSTRM-185]
|
||||
_ = x[FCMA-186]
|
||||
_ = x[FP-187]
|
||||
_ = x[FPHP-188]
|
||||
_ = x[GPA-189]
|
||||
_ = x[JSCVT-190]
|
||||
_ = x[LRCPC-191]
|
||||
_ = x[PMULL-192]
|
||||
_ = x[SHA1-193]
|
||||
_ = x[SHA2-194]
|
||||
_ = x[SHA3-195]
|
||||
_ = x[SHA512-196]
|
||||
_ = x[SM3-197]
|
||||
_ = x[SM4-198]
|
||||
_ = x[SVE-199]
|
||||
_ = x[lastID-200]
|
||||
_ = x[APX_F-9]
|
||||
_ = x[AVX-10]
|
||||
_ = x[AVX10-11]
|
||||
_ = x[AVX10_128-12]
|
||||
_ = x[AVX10_256-13]
|
||||
_ = x[AVX10_512-14]
|
||||
_ = x[AVX2-15]
|
||||
_ = x[AVX512BF16-16]
|
||||
_ = x[AVX512BITALG-17]
|
||||
_ = x[AVX512BW-18]
|
||||
_ = x[AVX512CD-19]
|
||||
_ = x[AVX512DQ-20]
|
||||
_ = x[AVX512ER-21]
|
||||
_ = x[AVX512F-22]
|
||||
_ = x[AVX512FP16-23]
|
||||
_ = x[AVX512IFMA-24]
|
||||
_ = x[AVX512PF-25]
|
||||
_ = x[AVX512VBMI-26]
|
||||
_ = x[AVX512VBMI2-27]
|
||||
_ = x[AVX512VL-28]
|
||||
_ = x[AVX512VNNI-29]
|
||||
_ = x[AVX512VP2INTERSECT-30]
|
||||
_ = x[AVX512VPOPCNTDQ-31]
|
||||
_ = x[AVXIFMA-32]
|
||||
_ = x[AVXNECONVERT-33]
|
||||
_ = x[AVXSLOW-34]
|
||||
_ = x[AVXVNNI-35]
|
||||
_ = x[AVXVNNIINT8-36]
|
||||
_ = x[BHI_CTRL-37]
|
||||
_ = x[BMI1-38]
|
||||
_ = x[BMI2-39]
|
||||
_ = x[CETIBT-40]
|
||||
_ = x[CETSS-41]
|
||||
_ = x[CLDEMOTE-42]
|
||||
_ = x[CLMUL-43]
|
||||
_ = x[CLZERO-44]
|
||||
_ = x[CMOV-45]
|
||||
_ = x[CMPCCXADD-46]
|
||||
_ = x[CMPSB_SCADBS_SHORT-47]
|
||||
_ = x[CMPXCHG8-48]
|
||||
_ = x[CPBOOST-49]
|
||||
_ = x[CPPC-50]
|
||||
_ = x[CX16-51]
|
||||
_ = x[EFER_LMSLE_UNS-52]
|
||||
_ = x[ENQCMD-53]
|
||||
_ = x[ERMS-54]
|
||||
_ = x[F16C-55]
|
||||
_ = x[FLUSH_L1D-56]
|
||||
_ = x[FMA3-57]
|
||||
_ = x[FMA4-58]
|
||||
_ = x[FP128-59]
|
||||
_ = x[FP256-60]
|
||||
_ = x[FSRM-61]
|
||||
_ = x[FXSR-62]
|
||||
_ = x[FXSROPT-63]
|
||||
_ = x[GFNI-64]
|
||||
_ = x[HLE-65]
|
||||
_ = x[HRESET-66]
|
||||
_ = x[HTT-67]
|
||||
_ = x[HWA-68]
|
||||
_ = x[HYBRID_CPU-69]
|
||||
_ = x[HYPERVISOR-70]
|
||||
_ = x[IA32_ARCH_CAP-71]
|
||||
_ = x[IA32_CORE_CAP-72]
|
||||
_ = x[IBPB-73]
|
||||
_ = x[IBRS-74]
|
||||
_ = x[IBRS_PREFERRED-75]
|
||||
_ = x[IBRS_PROVIDES_SMP-76]
|
||||
_ = x[IBS-77]
|
||||
_ = x[IBSBRNTRGT-78]
|
||||
_ = x[IBSFETCHSAM-79]
|
||||
_ = x[IBSFFV-80]
|
||||
_ = x[IBSOPCNT-81]
|
||||
_ = x[IBSOPCNTEXT-82]
|
||||
_ = x[IBSOPSAM-83]
|
||||
_ = x[IBSRDWROPCNT-84]
|
||||
_ = x[IBSRIPINVALIDCHK-85]
|
||||
_ = x[IBS_FETCH_CTLX-86]
|
||||
_ = x[IBS_OPDATA4-87]
|
||||
_ = x[IBS_OPFUSE-88]
|
||||
_ = x[IBS_PREVENTHOST-89]
|
||||
_ = x[IBS_ZEN4-90]
|
||||
_ = x[IDPRED_CTRL-91]
|
||||
_ = x[INT_WBINVD-92]
|
||||
_ = x[INVLPGB-93]
|
||||
_ = x[KEYLOCKER-94]
|
||||
_ = x[KEYLOCKERW-95]
|
||||
_ = x[LAHF-96]
|
||||
_ = x[LAM-97]
|
||||
_ = x[LBRVIRT-98]
|
||||
_ = x[LZCNT-99]
|
||||
_ = x[MCAOVERFLOW-100]
|
||||
_ = x[MCDT_NO-101]
|
||||
_ = x[MCOMMIT-102]
|
||||
_ = x[MD_CLEAR-103]
|
||||
_ = x[MMX-104]
|
||||
_ = x[MMXEXT-105]
|
||||
_ = x[MOVBE-106]
|
||||
_ = x[MOVDIR64B-107]
|
||||
_ = x[MOVDIRI-108]
|
||||
_ = x[MOVSB_ZL-109]
|
||||
_ = x[MOVU-110]
|
||||
_ = x[MPX-111]
|
||||
_ = x[MSRIRC-112]
|
||||
_ = x[MSRLIST-113]
|
||||
_ = x[MSR_PAGEFLUSH-114]
|
||||
_ = x[NRIPS-115]
|
||||
_ = x[NX-116]
|
||||
_ = x[OSXSAVE-117]
|
||||
_ = x[PCONFIG-118]
|
||||
_ = x[POPCNT-119]
|
||||
_ = x[PPIN-120]
|
||||
_ = x[PREFETCHI-121]
|
||||
_ = x[PSFD-122]
|
||||
_ = x[RDPRU-123]
|
||||
_ = x[RDRAND-124]
|
||||
_ = x[RDSEED-125]
|
||||
_ = x[RDTSCP-126]
|
||||
_ = x[RRSBA_CTRL-127]
|
||||
_ = x[RTM-128]
|
||||
_ = x[RTM_ALWAYS_ABORT-129]
|
||||
_ = x[SERIALIZE-130]
|
||||
_ = x[SEV-131]
|
||||
_ = x[SEV_64BIT-132]
|
||||
_ = x[SEV_ALTERNATIVE-133]
|
||||
_ = x[SEV_DEBUGSWAP-134]
|
||||
_ = x[SEV_ES-135]
|
||||
_ = x[SEV_RESTRICTED-136]
|
||||
_ = x[SEV_SNP-137]
|
||||
_ = x[SGX-138]
|
||||
_ = x[SGXLC-139]
|
||||
_ = x[SHA-140]
|
||||
_ = x[SME-141]
|
||||
_ = x[SME_COHERENT-142]
|
||||
_ = x[SPEC_CTRL_SSBD-143]
|
||||
_ = x[SRBDS_CTRL-144]
|
||||
_ = x[SSE-145]
|
||||
_ = x[SSE2-146]
|
||||
_ = x[SSE3-147]
|
||||
_ = x[SSE4-148]
|
||||
_ = x[SSE42-149]
|
||||
_ = x[SSE4A-150]
|
||||
_ = x[SSSE3-151]
|
||||
_ = x[STIBP-152]
|
||||
_ = x[STIBP_ALWAYSON-153]
|
||||
_ = x[STOSB_SHORT-154]
|
||||
_ = x[SUCCOR-155]
|
||||
_ = x[SVM-156]
|
||||
_ = x[SVMDA-157]
|
||||
_ = x[SVMFBASID-158]
|
||||
_ = x[SVML-159]
|
||||
_ = x[SVMNP-160]
|
||||
_ = x[SVMPF-161]
|
||||
_ = x[SVMPFT-162]
|
||||
_ = x[SYSCALL-163]
|
||||
_ = x[SYSEE-164]
|
||||
_ = x[TBM-165]
|
||||
_ = x[TDX_GUEST-166]
|
||||
_ = x[TLB_FLUSH_NESTED-167]
|
||||
_ = x[TME-168]
|
||||
_ = x[TOPEXT-169]
|
||||
_ = x[TSCRATEMSR-170]
|
||||
_ = x[TSXLDTRK-171]
|
||||
_ = x[VAES-172]
|
||||
_ = x[VMCBCLEAN-173]
|
||||
_ = x[VMPL-174]
|
||||
_ = x[VMSA_REGPROT-175]
|
||||
_ = x[VMX-176]
|
||||
_ = x[VPCLMULQDQ-177]
|
||||
_ = x[VTE-178]
|
||||
_ = x[WAITPKG-179]
|
||||
_ = x[WBNOINVD-180]
|
||||
_ = x[WRMSRNS-181]
|
||||
_ = x[X87-182]
|
||||
_ = x[XGETBV1-183]
|
||||
_ = x[XOP-184]
|
||||
_ = x[XSAVE-185]
|
||||
_ = x[XSAVEC-186]
|
||||
_ = x[XSAVEOPT-187]
|
||||
_ = x[XSAVES-188]
|
||||
_ = x[AESARM-189]
|
||||
_ = x[ARMCPUID-190]
|
||||
_ = x[ASIMD-191]
|
||||
_ = x[ASIMDDP-192]
|
||||
_ = x[ASIMDHP-193]
|
||||
_ = x[ASIMDRDM-194]
|
||||
_ = x[ATOMICS-195]
|
||||
_ = x[CRC32-196]
|
||||
_ = x[DCPOP-197]
|
||||
_ = x[EVTSTRM-198]
|
||||
_ = x[FCMA-199]
|
||||
_ = x[FP-200]
|
||||
_ = x[FPHP-201]
|
||||
_ = x[GPA-202]
|
||||
_ = x[JSCVT-203]
|
||||
_ = x[LRCPC-204]
|
||||
_ = x[PMULL-205]
|
||||
_ = x[SHA1-206]
|
||||
_ = x[SHA2-207]
|
||||
_ = x[SHA3-208]
|
||||
_ = x[SHA512-209]
|
||||
_ = x[SM3-210]
|
||||
_ = x[SM4-211]
|
||||
_ = x[SVE-212]
|
||||
_ = x[lastID-213]
|
||||
_ = x[firstID-0]
|
||||
}
|
||||
|
||||
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4INT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
|
||||
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
|
||||
|
||||
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 278, 282, 288, 293, 301, 306, 312, 316, 325, 343, 351, 358, 362, 366, 380, 386, 390, 394, 403, 407, 411, 416, 421, 425, 429, 436, 440, 443, 449, 452, 455, 465, 475, 488, 501, 505, 509, 523, 540, 543, 553, 564, 570, 578, 589, 597, 609, 625, 639, 650, 660, 675, 683, 693, 700, 704, 707, 714, 719, 730, 737, 744, 752, 755, 761, 766, 775, 782, 790, 794, 797, 803, 816, 821, 823, 830, 837, 843, 847, 856, 860, 865, 871, 877, 883, 886, 902, 911, 914, 923, 938, 951, 957, 971, 978, 981, 986, 989, 992, 1004, 1018, 1028, 1031, 1035, 1039, 1043, 1048, 1053, 1058, 1063, 1077, 1088, 1094, 1097, 1102, 1111, 1115, 1120, 1125, 1131, 1138, 1143, 1146, 1162, 1165, 1171, 1181, 1189, 1193, 1202, 1206, 1218, 1221, 1231, 1234, 1241, 1249, 1252, 1259, 1262, 1267, 1273, 1281, 1287, 1293, 1301, 1306, 1313, 1320, 1328, 1335, 1340, 1345, 1352, 1356, 1358, 1362, 1365, 1370, 1375, 1380, 1384, 1388, 1392, 1398, 1401, 1404, 1407, 1413}
|
||||
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 319, 323, 327, 333, 338, 346, 351, 357, 361, 370, 388, 396, 403, 407, 411, 425, 431, 435, 439, 448, 452, 456, 461, 466, 470, 474, 481, 485, 488, 494, 497, 500, 510, 520, 533, 546, 550, 554, 568, 585, 588, 598, 609, 615, 623, 634, 642, 654, 670, 684, 695, 705, 720, 728, 739, 749, 756, 765, 775, 779, 782, 789, 794, 805, 812, 819, 827, 830, 836, 841, 850, 857, 865, 869, 872, 878, 885, 898, 903, 905, 912, 919, 925, 929, 938, 942, 947, 953, 959, 965, 975, 978, 994, 1003, 1006, 1015, 1030, 1043, 1049, 1063, 1070, 1073, 1078, 1081, 1084, 1096, 1110, 1120, 1123, 1127, 1131, 1135, 1140, 1145, 1150, 1155, 1169, 1180, 1186, 1189, 1194, 1203, 1207, 1212, 1217, 1223, 1230, 1235, 1238, 1247, 1263, 1266, 1272, 1282, 1290, 1294, 1303, 1307, 1319, 1322, 1332, 1335, 1342, 1350, 1357, 1360, 1367, 1370, 1375, 1381, 1389, 1395, 1401, 1409, 1414, 1421, 1428, 1436, 1443, 1448, 1453, 1460, 1464, 1466, 1470, 1473, 1478, 1483, 1488, 1492, 1496, 1500, 1506, 1509, 1512, 1515, 1521}
|
||||
|
||||
func (i FeatureID) String() string {
|
||||
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
|
||||
|
||||
+15
@@ -534,6 +534,21 @@ BenchmarkGaloisXor128K-160 862.02 7905.00 9.17x
|
||||
BenchmarkGaloisXor1M-160 784.60 6296.65 8.03x
|
||||
```
|
||||
|
||||
# Legal
|
||||
|
||||
> None of section below is legal advice. Seek your own legal counsel.
|
||||
> As stated by the [LICENSE](LICENSE) the authors will not be held reliable for any use of this library.
|
||||
> Users are encouraged to independently verify they comply with all legal requirements.
|
||||
|
||||
As can be seen in [recent news](https://www.datanami.com/2023/10/16/cloudera-hit-with-240-million-judgement-over-erasure-coding/)
|
||||
there has been lawsuits related to possible patents of aspects of erasure coding functionality.
|
||||
|
||||
As a possible mitigation it is possible to use the tag `nopshufb` when compiling any code which includes this package.
|
||||
This will remove all inclusion and use of `PSHUFB` and equivalent on other platforms.
|
||||
|
||||
This is done by adding `-tags=nopshufb` to `go build` and similar commands that produce binary output.
|
||||
|
||||
The removed code may not be infringing and even after `-tags=nopshufb` there may still be infringing code left.
|
||||
|
||||
# Links
|
||||
* [Backblaze Open Sources Reed-Solomon Erasure Coding Source Code](https://www.backblaze.com/blog/reed-solomon/).
|
||||
|
||||
+16
-9
@@ -6,7 +6,9 @@
|
||||
|
||||
package reedsolomon
|
||||
|
||||
import "encoding/binary"
|
||||
import (
|
||||
"encoding/binary"
|
||||
)
|
||||
|
||||
const (
|
||||
// The number of elements in the field.
|
||||
@@ -60,21 +62,17 @@ var logTable = [fieldSize]byte{
|
||||
|
||||
/**
|
||||
* Inverse of the logarithm table. Maps integer logarithms
|
||||
* to members of the field. There is no entry for 255
|
||||
* because the highest log is 254.
|
||||
* to members of the field. Entry 255 is the same as entry 0 sue to mod 255.
|
||||
*
|
||||
* This table was generated by `go run gentables.go`
|
||||
* Table has been truncated to 256 bytes, since no lookups are bigger.
|
||||
*/
|
||||
var expTable = []byte{0x1, 0x2, 0x4, 0x8, 0x10, 0x20, 0x40, 0x80, 0x1d, 0x3a, 0x74, 0xe8, 0xcd, 0x87, 0x13, 0x26, 0x4c, 0x98, 0x2d, 0x5a, 0xb4, 0x75, 0xea, 0xc9, 0x8f, 0x3, 0x6, 0xc, 0x18, 0x30, 0x60, 0xc0, 0x9d, 0x27, 0x4e, 0x9c, 0x25, 0x4a, 0x94, 0x35, 0x6a, 0xd4, 0xb5, 0x77, 0xee, 0xc1, 0x9f, 0x23, 0x46, 0x8c, 0x5, 0xa, 0x14, 0x28, 0x50, 0xa0, 0x5d, 0xba, 0x69, 0xd2, 0xb9, 0x6f, 0xde, 0xa1, 0x5f, 0xbe, 0x61, 0xc2, 0x99, 0x2f, 0x5e, 0xbc, 0x65, 0xca, 0x89, 0xf, 0x1e, 0x3c, 0x78, 0xf0, 0xfd, 0xe7, 0xd3, 0xbb, 0x6b, 0xd6, 0xb1, 0x7f, 0xfe, 0xe1, 0xdf, 0xa3, 0x5b, 0xb6, 0x71, 0xe2, 0xd9, 0xaf, 0x43, 0x86, 0x11, 0x22, 0x44, 0x88, 0xd, 0x1a, 0x34, 0x68, 0xd0, 0xbd, 0x67, 0xce, 0x81, 0x1f, 0x3e, 0x7c, 0xf8, 0xed, 0xc7, 0x93, 0x3b, 0x76, 0xec, 0xc5, 0x97, 0x33, 0x66, 0xcc, 0x85, 0x17, 0x2e, 0x5c, 0xb8, 0x6d, 0xda, 0xa9, 0x4f, 0x9e, 0x21, 0x42, 0x84, 0x15, 0x2a, 0x54, 0xa8, 0x4d, 0x9a, 0x29, 0x52, 0xa4, 0x55, 0xaa, 0x49, 0x92, 0x39, 0x72, 0xe4, 0xd5, 0xb7, 0x73, 0xe6, 0xd1, 0xbf, 0x63, 0xc6, 0x91, 0x3f, 0x7e, 0xfc, 0xe5, 0xd7, 0xb3, 0x7b, 0xf6, 0xf1, 0xff, 0xe3, 0xdb, 0xab, 0x4b, 0x96, 0x31, 0x62, 0xc4, 0x95, 0x37, 0x6e, 0xdc, 0xa5, 0x57, 0xae, 0x41, 0x82, 0x19, 0x32, 0x64, 0xc8, 0x8d, 0x7, 0xe, 0x1c, 0x38, 0x70, 0xe0, 0xdd, 0xa7, 0x53, 0xa6, 0x51, 0xa2, 0x59, 0xb2, 0x79, 0xf2, 0xf9, 0xef, 0xc3, 0x9b, 0x2b, 0x56, 0xac, 0x45, 0x8a, 0x9, 0x12, 0x24, 0x48, 0x90, 0x3d, 0x7a, 0xf4, 0xf5, 0xf7, 0xf3, 0xfb, 0xeb, 0xcb, 0x8b, 0xb, 0x16, 0x2c, 0x58, 0xb0, 0x7d, 0xfa, 0xe9, 0xcf, 0x83, 0x1b, 0x36, 0x6c, 0xd8, 0xad, 0x47, 0x8e, 0x1, 0x2, 0x4, 0x8, 0x10, 0x20, 0x40, 0x80, 0x1d, 0x3a, 0x74, 0xe8, 0xcd, 0x87, 0x13, 0x26, 0x4c, 0x98, 0x2d, 0x5a, 0xb4, 0x75, 0xea, 0xc9, 0x8f, 0x3, 0x6, 0xc, 0x18, 0x30, 0x60, 0xc0, 0x9d, 0x27, 0x4e, 0x9c, 0x25, 0x4a, 0x94, 0x35, 0x6a, 0xd4, 0xb5, 0x77, 0xee, 0xc1, 0x9f, 0x23, 0x46, 0x8c, 0x5, 0xa, 0x14, 0x28, 0x50, 0xa0, 0x5d, 0xba, 0x69, 0xd2, 0xb9, 0x6f, 0xde, 0xa1, 0x5f, 0xbe, 0x61, 0xc2, 0x99, 0x2f, 0x5e, 0xbc, 0x65, 0xca, 0x89, 0xf, 0x1e, 0x3c, 0x78, 0xf0, 0xfd, 0xe7, 0xd3, 0xbb, 0x6b, 0xd6, 0xb1, 0x7f, 0xfe, 0xe1, 0xdf, 0xa3, 0x5b, 0xb6, 0x71, 0xe2, 0xd9, 0xaf, 0x43, 0x86, 0x11, 0x22, 0x44, 0x88, 0xd, 0x1a, 0x34, 0x68, 0xd0, 0xbd, 0x67, 0xce, 0x81, 0x1f, 0x3e, 0x7c, 0xf8, 0xed, 0xc7, 0x93, 0x3b, 0x76, 0xec, 0xc5, 0x97, 0x33, 0x66, 0xcc, 0x85, 0x17, 0x2e, 0x5c, 0xb8, 0x6d, 0xda, 0xa9, 0x4f, 0x9e, 0x21, 0x42, 0x84, 0x15, 0x2a, 0x54, 0xa8, 0x4d, 0x9a, 0x29, 0x52, 0xa4, 0x55, 0xaa, 0x49, 0x92, 0x39, 0x72, 0xe4, 0xd5, 0xb7, 0x73, 0xe6, 0xd1, 0xbf, 0x63, 0xc6, 0x91, 0x3f, 0x7e, 0xfc, 0xe5, 0xd7, 0xb3, 0x7b, 0xf6, 0xf1, 0xff, 0xe3, 0xdb, 0xab, 0x4b, 0x96, 0x31, 0x62, 0xc4, 0x95, 0x37, 0x6e, 0xdc, 0xa5, 0x57, 0xae, 0x41, 0x82, 0x19, 0x32, 0x64, 0xc8, 0x8d, 0x7, 0xe, 0x1c, 0x38, 0x70, 0xe0, 0xdd, 0xa7, 0x53, 0xa6, 0x51, 0xa2, 0x59, 0xb2, 0x79, 0xf2, 0xf9, 0xef, 0xc3, 0x9b, 0x2b, 0x56, 0xac, 0x45, 0x8a, 0x9, 0x12, 0x24, 0x48, 0x90, 0x3d, 0x7a, 0xf4, 0xf5, 0xf7, 0xf3, 0xfb, 0xeb, 0xcb, 0x8b, 0xb, 0x16, 0x2c, 0x58, 0xb0, 0x7d, 0xfa, 0xe9, 0xcf, 0x83, 0x1b, 0x36, 0x6c, 0xd8, 0xad, 0x47, 0x8e}
|
||||
var expTable = [256]byte{0x1, 0x2, 0x4, 0x8, 0x10, 0x20, 0x40, 0x80, 0x1d, 0x3a, 0x74, 0xe8, 0xcd, 0x87, 0x13, 0x26, 0x4c, 0x98, 0x2d, 0x5a, 0xb4, 0x75, 0xea, 0xc9, 0x8f, 0x3, 0x6, 0xc, 0x18, 0x30, 0x60, 0xc0, 0x9d, 0x27, 0x4e, 0x9c, 0x25, 0x4a, 0x94, 0x35, 0x6a, 0xd4, 0xb5, 0x77, 0xee, 0xc1, 0x9f, 0x23, 0x46, 0x8c, 0x5, 0xa, 0x14, 0x28, 0x50, 0xa0, 0x5d, 0xba, 0x69, 0xd2, 0xb9, 0x6f, 0xde, 0xa1, 0x5f, 0xbe, 0x61, 0xc2, 0x99, 0x2f, 0x5e, 0xbc, 0x65, 0xca, 0x89, 0xf, 0x1e, 0x3c, 0x78, 0xf0, 0xfd, 0xe7, 0xd3, 0xbb, 0x6b, 0xd6, 0xb1, 0x7f, 0xfe, 0xe1, 0xdf, 0xa3, 0x5b, 0xb6, 0x71, 0xe2, 0xd9, 0xaf, 0x43, 0x86, 0x11, 0x22, 0x44, 0x88, 0xd, 0x1a, 0x34, 0x68, 0xd0, 0xbd, 0x67, 0xce, 0x81, 0x1f, 0x3e, 0x7c, 0xf8, 0xed, 0xc7, 0x93, 0x3b, 0x76, 0xec, 0xc5, 0x97, 0x33, 0x66, 0xcc, 0x85, 0x17, 0x2e, 0x5c, 0xb8, 0x6d, 0xda, 0xa9, 0x4f, 0x9e, 0x21, 0x42, 0x84, 0x15, 0x2a, 0x54, 0xa8, 0x4d, 0x9a, 0x29, 0x52, 0xa4, 0x55, 0xaa, 0x49, 0x92, 0x39, 0x72, 0xe4, 0xd5, 0xb7, 0x73, 0xe6, 0xd1, 0xbf, 0x63, 0xc6, 0x91, 0x3f, 0x7e, 0xfc, 0xe5, 0xd7, 0xb3, 0x7b, 0xf6, 0xf1, 0xff, 0xe3, 0xdb, 0xab, 0x4b, 0x96, 0x31, 0x62, 0xc4, 0x95, 0x37, 0x6e, 0xdc, 0xa5, 0x57, 0xae, 0x41, 0x82, 0x19, 0x32, 0x64, 0xc8, 0x8d, 0x7, 0xe, 0x1c, 0x38, 0x70, 0xe0, 0xdd, 0xa7, 0x53, 0xa6, 0x51, 0xa2, 0x59, 0xb2, 0x79, 0xf2, 0xf9, 0xef, 0xc3, 0x9b, 0x2b, 0x56, 0xac, 0x45, 0x8a, 0x9, 0x12, 0x24, 0x48, 0x90, 0x3d, 0x7a, 0xf4, 0xf5, 0xf7, 0xf3, 0xfb, 0xeb, 0xcb, 0x8b, 0xb, 0x16, 0x2c, 0x58, 0xb0, 0x7d, 0xfa, 0xe9, 0xcf, 0x83, 0x1b, 0x36, 0x6c, 0xd8, 0xad, 0x47, 0x8e, 0x1}
|
||||
|
||||
func galAdd(a, b byte) byte {
|
||||
return a ^ b
|
||||
}
|
||||
|
||||
func galSub(a, b byte) byte {
|
||||
return a ^ b
|
||||
}
|
||||
|
||||
// Table from https://github.com/templexxx/reedsolomon
|
||||
var invTable = [256]byte{0x0, 0x1, 0x8e, 0xf4, 0x47, 0xa7, 0x7a, 0xba, 0xad, 0x9d, 0xdd, 0x98, 0x3d, 0xaa, 0x5d, 0x96, 0xd8, 0x72, 0xc0, 0x58, 0xe0, 0x3e, 0x4c, 0x66, 0x90, 0xde, 0x55, 0x80, 0xa0, 0x83, 0x4b, 0x2a, 0x6c, 0xed, 0x39, 0x51, 0x60, 0x56, 0x2c, 0x8a, 0x70, 0xd0, 0x1f, 0x4a, 0x26, 0x8b, 0x33, 0x6e, 0x48, 0x89, 0x6f, 0x2e, 0xa4, 0xc3, 0x40, 0x5e, 0x50, 0x22, 0xcf, 0xa9, 0xab, 0xc, 0x15, 0xe1, 0x36, 0x5f, 0xf8, 0xd5, 0x92, 0x4e, 0xa6, 0x4, 0x30, 0x88, 0x2b, 0x1e, 0x16, 0x67, 0x45, 0x93, 0x38, 0x23, 0x68, 0x8c, 0x81, 0x1a, 0x25, 0x61, 0x13, 0xc1, 0xcb, 0x63, 0x97, 0xe, 0x37, 0x41, 0x24, 0x57, 0xca, 0x5b, 0xb9, 0xc4, 0x17, 0x4d, 0x52, 0x8d, 0xef, 0xb3, 0x20, 0xec, 0x2f, 0x32, 0x28, 0xd1, 0x11, 0xd9, 0xe9, 0xfb, 0xda, 0x79, 0xdb, 0x77, 0x6, 0xbb, 0x84, 0xcd, 0xfe, 0xfc, 0x1b, 0x54, 0xa1, 0x1d, 0x7c, 0xcc, 0xe4, 0xb0, 0x49, 0x31, 0x27, 0x2d, 0x53, 0x69, 0x2, 0xf5, 0x18, 0xdf, 0x44, 0x4f, 0x9b, 0xbc, 0xf, 0x5c, 0xb, 0xdc, 0xbd, 0x94, 0xac, 0x9, 0xc7, 0xa2, 0x1c, 0x82, 0x9f, 0xc6, 0x34, 0xc2, 0x46, 0x5, 0xce, 0x3b, 0xd, 0x3c, 0x9c, 0x8, 0xbe, 0xb7, 0x87, 0xe5, 0xee, 0x6b, 0xeb, 0xf2, 0xbf, 0xaf, 0xc5, 0x64, 0x7, 0x7b, 0x95, 0x9a, 0xae, 0xb6, 0x12, 0x59, 0xa5, 0x35, 0x65, 0xb8, 0xa3, 0x9e, 0xd2, 0xf7, 0x62, 0x5a, 0x85, 0x7d, 0xa8, 0x3a, 0x29, 0x71, 0xc8, 0xf6, 0xf9, 0x43, 0xd7, 0xd6, 0x10, 0x73, 0x76, 0x78, 0x99, 0xa, 0x19, 0x91, 0x14, 0x3f, 0xe6, 0xf0, 0x86, 0xb1, 0xe2, 0xf1, 0xfa, 0x74, 0xf3, 0xb4, 0x6d, 0x21, 0xb2, 0x6a, 0xe3, 0xe7, 0xb5, 0xea, 0x3, 0x8f, 0xd3, 0xc9, 0x42, 0xd4, 0xe8, 0x75, 0x7f, 0xff, 0x7e, 0xfd}
|
||||
|
||||
@@ -881,6 +879,15 @@ func galDivide(a, b byte) byte {
|
||||
if logResult < 0 {
|
||||
logResult += 255
|
||||
}
|
||||
return expTable[uint8(logResult)]
|
||||
}
|
||||
|
||||
// galOneOver is the same as galDivide(1, a).
|
||||
func galOneOver(a byte) byte {
|
||||
if a == 0 {
|
||||
panic("Argument 'divisor' is 0")
|
||||
}
|
||||
logResult := logTable[a] ^ 255
|
||||
return expTable[logResult]
|
||||
}
|
||||
|
||||
@@ -900,7 +907,7 @@ func galExp(a byte, n int) byte {
|
||||
for logResult >= 255 {
|
||||
logResult -= 255
|
||||
}
|
||||
return expTable[logResult]
|
||||
return expTable[uint8(logResult)]
|
||||
}
|
||||
|
||||
func genAvx2Matrix(matrixRows [][]byte, inputs, inIdx, outputs int, dst []byte) []byte {
|
||||
|
||||
+3
-11
@@ -1,10 +1,11 @@
|
||||
//go:build !noasm && !appengine && !gccgo
|
||||
// +build !noasm,!appengine,!gccgo
|
||||
//go:build !noasm && !appengine && !gccgo && !nopshufb
|
||||
|
||||
// Copyright 2015, Klaus Post, see LICENSE for details.
|
||||
|
||||
package reedsolomon
|
||||
|
||||
const pshufb = true
|
||||
|
||||
//go:noescape
|
||||
func galMulSSSE3(low, high, in, out []byte)
|
||||
|
||||
@@ -17,21 +18,12 @@ func galMulAVX2Xor(low, high, in, out []byte)
|
||||
//go:noescape
|
||||
func galMulAVX2(low, high, in, out []byte)
|
||||
|
||||
//go:noescape
|
||||
func sSE2XorSlice(in, out []byte)
|
||||
|
||||
//go:noescape
|
||||
func galMulAVX2Xor_64(low, high, in, out []byte)
|
||||
|
||||
//go:noescape
|
||||
func galMulAVX2_64(low, high, in, out []byte)
|
||||
|
||||
//go:noescape
|
||||
func sSE2XorSlice_64(in, out []byte)
|
||||
|
||||
//go:noescape
|
||||
func avx2XorSlice_64(in, out []byte)
|
||||
|
||||
// This is what the assembler routines do in blocks of 16 bytes:
|
||||
/*
|
||||
func galMulSSSE3(low, high, in, out []byte) {
|
||||
|
||||
+1
-85
@@ -1,6 +1,7 @@
|
||||
//+build !noasm
|
||||
//+build !appengine
|
||||
//+build !gccgo
|
||||
//+build !nopshufb
|
||||
|
||||
// Copyright 2015, Klaus Post, see LICENSE for details.
|
||||
|
||||
@@ -215,28 +216,6 @@ done_avx2:
|
||||
VZEROUPPER
|
||||
RET
|
||||
|
||||
// func sSE2XorSlice(in, out []byte)
|
||||
TEXT ·sSE2XorSlice(SB), 7, $0
|
||||
MOVQ in+0(FP), SI // SI: &in
|
||||
MOVQ in_len+8(FP), R9 // R9: len(in)
|
||||
MOVQ out+24(FP), DX // DX: &out
|
||||
SHRQ $4, R9 // len(in) / 16
|
||||
CMPQ R9, $0
|
||||
JEQ done_xor_sse2
|
||||
|
||||
loopback_xor_sse2:
|
||||
MOVOU (SI), X0 // in[x]
|
||||
MOVOU (DX), X1 // out[x]
|
||||
PXOR X0, X1
|
||||
MOVOU X1, (DX)
|
||||
ADDQ $16, SI // in+=16
|
||||
ADDQ $16, DX // out+=16
|
||||
SUBQ $1, R9
|
||||
JNZ loopback_xor_sse2
|
||||
|
||||
done_xor_sse2:
|
||||
RET
|
||||
|
||||
// func galMulAVX2Xor_64(low, high, in, out []byte)
|
||||
TEXT ·galMulAVX2Xor_64(SB), 7, $0
|
||||
MOVQ low+0(FP), SI // SI: &low
|
||||
@@ -329,66 +308,3 @@ loopback_avx2_64:
|
||||
done_avx2_64:
|
||||
VZEROUPPER
|
||||
RET
|
||||
|
||||
// func sSE2XorSlice_64(in, out []byte)
|
||||
TEXT ·sSE2XorSlice_64(SB), 7, $0
|
||||
MOVQ in+0(FP), SI // SI: &in
|
||||
MOVQ in_len+8(FP), R9 // R9: len(in)
|
||||
MOVQ out+24(FP), DX // DX: &out
|
||||
SHRQ $6, R9 // len(in) / 64
|
||||
CMPQ R9, $0
|
||||
JEQ done_xor_sse2_64
|
||||
|
||||
loopback_xor_sse2_64:
|
||||
MOVOU (SI), X0 // in[x]
|
||||
MOVOU 16(SI), X2 // in[x]
|
||||
MOVOU 32(SI), X4 // in[x]
|
||||
MOVOU 48(SI), X6 // in[x]
|
||||
MOVOU (DX), X1 // out[x]
|
||||
MOVOU 16(DX), X3 // out[x]
|
||||
MOVOU 32(DX), X5 // out[x]
|
||||
MOVOU 48(DX), X7 // out[x]
|
||||
PXOR X0, X1
|
||||
PXOR X2, X3
|
||||
PXOR X4, X5
|
||||
PXOR X6, X7
|
||||
MOVOU X1, (DX)
|
||||
MOVOU X3, 16(DX)
|
||||
MOVOU X5, 32(DX)
|
||||
MOVOU X7, 48(DX)
|
||||
ADDQ $64, SI // in+=64
|
||||
ADDQ $64, DX // out+=64
|
||||
SUBQ $1, R9
|
||||
JNZ loopback_xor_sse2_64
|
||||
|
||||
done_xor_sse2_64:
|
||||
RET
|
||||
|
||||
// func avx2XorSlice_64(in, out []byte)
|
||||
TEXT ·avx2XorSlice_64(SB), 7, $0
|
||||
MOVQ in+0(FP), SI // SI: &in
|
||||
MOVQ in_len+8(FP), R9 // R9: len(in)
|
||||
MOVQ out+24(FP), DX // DX: &out
|
||||
SHRQ $6, R9 // len(in) / 64
|
||||
CMPQ R9, $0
|
||||
JEQ done_xor_avx2_64
|
||||
|
||||
loopback_xor_avx2_64:
|
||||
VMOVDQU (SI), Y0
|
||||
VMOVDQU 32(SI), Y2
|
||||
VMOVDQU (DX), Y1
|
||||
VMOVDQU 32(DX), Y3
|
||||
VPXOR Y0, Y1, Y1
|
||||
VPXOR Y2, Y3, Y3
|
||||
VMOVDQU Y1, (DX)
|
||||
VMOVDQU Y3, 32(DX)
|
||||
|
||||
ADDQ $64, SI // in+=64
|
||||
ADDQ $64, DX // out+=64
|
||||
SUBQ $1, R9
|
||||
JNZ loopback_xor_avx2_64
|
||||
VZEROUPPER
|
||||
|
||||
done_xor_avx2_64:
|
||||
|
||||
RET
|
||||
|
||||
+5
-21
@@ -1,20 +1,18 @@
|
||||
//go:build !noasm && !appengine && !gccgo
|
||||
// +build !noasm,!appengine,!gccgo
|
||||
//go:build !noasm && !appengine && !gccgo && !nopshufb
|
||||
|
||||
// Copyright 2015, Klaus Post, see LICENSE for details.
|
||||
// Copyright 2017, Minio, Inc.
|
||||
|
||||
package reedsolomon
|
||||
|
||||
const pshufb = true
|
||||
|
||||
//go:noescape
|
||||
func galMulNEON(low, high, in, out []byte)
|
||||
|
||||
//go:noescape
|
||||
func galMulXorNEON(low, high, in, out []byte)
|
||||
|
||||
//go:noescape
|
||||
func galXorNEON(in, out []byte)
|
||||
|
||||
func galMulSlice(c byte, in, out []byte, o *options) {
|
||||
if c == 1 {
|
||||
copy(out, in)
|
||||
@@ -51,20 +49,6 @@ func galMulSliceXor(c byte, in, out []byte, o *options) {
|
||||
}
|
||||
}
|
||||
|
||||
// simple slice xor
|
||||
func sliceXor(in, out []byte, o *options) {
|
||||
|
||||
galXorNEON(in, out)
|
||||
done := (len(in) >> 5) << 5
|
||||
|
||||
remain := len(in) - done
|
||||
if remain > 0 {
|
||||
for i := done; i < len(in); i++ {
|
||||
out[i] ^= in[i]
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
// 4-way butterfly
|
||||
func ifftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
|
||||
ifftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
|
||||
@@ -90,7 +74,7 @@ func fftDIT2(x, y []byte, log_m ffe, o *options) {
|
||||
// Reference version:
|
||||
refMulAdd(x, y, log_m)
|
||||
// 64 byte aligned, always full.
|
||||
galXorNEON(x, y)
|
||||
xorSliceNEON(x, y)
|
||||
}
|
||||
|
||||
// 2-way butterfly forward
|
||||
@@ -103,7 +87,7 @@ func fftDIT28(x, y []byte, log_m ffe8, o *options) {
|
||||
// 2-way butterfly
|
||||
func ifftDIT2(x, y []byte, log_m ffe, o *options) {
|
||||
// 64 byte aligned, always full.
|
||||
galXorNEON(x, y)
|
||||
xorSliceNEON(x, y)
|
||||
// Reference version:
|
||||
refMulAdd(x, y, log_m)
|
||||
}
|
||||
|
||||
+1
-26
@@ -1,6 +1,7 @@
|
||||
//+build !noasm
|
||||
//+build !appengine
|
||||
//+build !gccgo
|
||||
//+build !nopshufb
|
||||
|
||||
// Copyright 2015, Klaus Post, see LICENSE for details.
|
||||
// Copyright 2017, Minio, Inc.
|
||||
@@ -99,29 +100,3 @@ loopXor:
|
||||
|
||||
completeXor:
|
||||
RET
|
||||
|
||||
// func galXorNEON(in, out []byte)
|
||||
TEXT ·galXorNEON(SB), 7, $0
|
||||
MOVD in_base+0(FP), R1
|
||||
MOVD in_len+8(FP), R2 // length of message
|
||||
MOVD out_base+24(FP), R5
|
||||
SUBS $32, R2
|
||||
BMI completeXor
|
||||
|
||||
loopXor:
|
||||
// Main loop
|
||||
VLD1.P 32(R1), [V0.B16, V1.B16]
|
||||
VLD1 (R5), [V20.B16, V21.B16]
|
||||
|
||||
VEOR V20.B16, V0.B16, V4.B16
|
||||
VEOR V21.B16, V1.B16, V5.B16
|
||||
|
||||
// Store result
|
||||
VST1.P [V4.D2, V5.D2], 32(R5)
|
||||
|
||||
SUBS $32, R2
|
||||
BPL loopXor
|
||||
|
||||
completeXor:
|
||||
RET
|
||||
|
||||
|
||||
+10
-1
@@ -1,11 +1,20 @@
|
||||
// Code generated by command: go run gen.go -out ../galois_gen_amd64.s -stubs ../galois_gen_amd64.go -pkg=reedsolomon. DO NOT EDIT.
|
||||
|
||||
//go:build !appengine && !noasm && !nogen && gc
|
||||
//go:build !appengine && !noasm && !nogen && !nopshufb && gc
|
||||
|
||||
package reedsolomon
|
||||
|
||||
func _dummy_()
|
||||
|
||||
//go:noescape
|
||||
func sSE2XorSlice(in []byte, out []byte)
|
||||
|
||||
//go:noescape
|
||||
func sSE2XorSlice_64(in []byte, out []byte)
|
||||
|
||||
//go:noescape
|
||||
func avx2XorSlice_64(in []byte, out []byte)
|
||||
|
||||
// mulAvxTwo_1x1 takes 1 inputs and produces 1 outputs.
|
||||
// The output is initialized to 0.
|
||||
//
|
||||
|
||||
+93
-1
@@ -1,6 +1,6 @@
|
||||
// Code generated by command: go run gen.go -out ../galois_gen_amd64.s -stubs ../galois_gen_amd64.go -pkg=reedsolomon. DO NOT EDIT.
|
||||
|
||||
//go:build !appengine && !noasm && !nogen && gc
|
||||
//go:build !appengine && !noasm && !nogen && !nopshufb && gc
|
||||
|
||||
#include "textflag.h"
|
||||
|
||||
@@ -18,6 +18,98 @@ TEXT ·_dummy_(SB), $0
|
||||
#endif
|
||||
RET
|
||||
|
||||
// sSE2XorSlice will XOR in with out and store in out.
|
||||
// Processes 16 bytes/loop.
|
||||
|
||||
// func sSE2XorSlice(in []byte, out []byte)
|
||||
// Requires: SSE2
|
||||
TEXT ·sSE2XorSlice(SB), $0-48
|
||||
MOVQ in_base+0(FP), AX
|
||||
MOVQ out_base+24(FP), CX
|
||||
MOVQ in_len+8(FP), DX
|
||||
SHRQ $0x04, DX
|
||||
JZ end
|
||||
|
||||
loop:
|
||||
MOVOU (AX), X0
|
||||
MOVOU (CX), X1
|
||||
PXOR X0, X1
|
||||
MOVOU X1, (CX)
|
||||
ADDQ $0x10, AX
|
||||
ADDQ $0x10, CX
|
||||
DECQ DX
|
||||
JNZ loop
|
||||
|
||||
end:
|
||||
RET
|
||||
|
||||
// sSE2XorSlice_64 will XOR in with out and store in out.
|
||||
// Processes 64 bytes/loop.
|
||||
|
||||
// func sSE2XorSlice_64(in []byte, out []byte)
|
||||
// Requires: SSE2
|
||||
TEXT ·sSE2XorSlice_64(SB), $0-48
|
||||
MOVQ in_base+0(FP), AX
|
||||
MOVQ out_base+24(FP), CX
|
||||
MOVQ in_len+8(FP), DX
|
||||
SHRQ $0x06, DX
|
||||
JZ end
|
||||
|
||||
loop:
|
||||
MOVOU (AX), X0
|
||||
MOVOU 16(AX), X2
|
||||
MOVOU 32(AX), X4
|
||||
MOVOU 48(AX), X6
|
||||
MOVOU (CX), X1
|
||||
MOVOU 16(CX), X3
|
||||
MOVOU 32(CX), X5
|
||||
MOVOU 48(CX), X7
|
||||
PXOR X0, X1
|
||||
PXOR X2, X3
|
||||
PXOR X4, X5
|
||||
PXOR X6, X7
|
||||
MOVOU X1, (CX)
|
||||
MOVOU X3, 16(CX)
|
||||
MOVOU X5, 32(CX)
|
||||
MOVOU X7, 48(CX)
|
||||
ADDQ $0x40, AX
|
||||
ADDQ $0x40, CX
|
||||
DECQ DX
|
||||
JNZ loop
|
||||
|
||||
end:
|
||||
RET
|
||||
|
||||
// avx2XorSlice_64 will XOR in with out and store in out.
|
||||
// Processes 64 bytes/loop.
|
||||
|
||||
// func avx2XorSlice_64(in []byte, out []byte)
|
||||
// Requires: AVX, AVX2
|
||||
TEXT ·avx2XorSlice_64(SB), $0-48
|
||||
MOVQ in_base+0(FP), AX
|
||||
MOVQ out_base+24(FP), CX
|
||||
MOVQ in_len+8(FP), DX
|
||||
SHRQ $0x06, DX
|
||||
JZ end
|
||||
|
||||
loop:
|
||||
VMOVDQU (AX), Y0
|
||||
VMOVDQU 32(AX), Y2
|
||||
VMOVDQU (CX), Y1
|
||||
VMOVDQU 32(CX), Y3
|
||||
VPXOR Y0, Y1, Y1
|
||||
VPXOR Y2, Y3, Y3
|
||||
VMOVDQU Y1, (CX)
|
||||
VMOVDQU Y3, 32(CX)
|
||||
ADDQ $0x40, AX
|
||||
ADDQ $0x40, CX
|
||||
DECQ DX
|
||||
JNZ loop
|
||||
|
||||
end:
|
||||
VZEROUPPER
|
||||
RET
|
||||
|
||||
// func mulAvxTwo_1x1(matrix []byte, in [][]byte, out [][]byte, start int, n int)
|
||||
// Requires: AVX, AVX2, SSE2
|
||||
TEXT ·mulAvxTwo_1x1(SB), NOSPLIT, $0-88
|
||||
|
||||
-1
@@ -1,5 +1,4 @@
|
||||
//go:build !amd64 || noasm || appengine || gccgo || nogen
|
||||
// +build !amd64 noasm appengine gccgo nogen
|
||||
|
||||
package reedsolomon
|
||||
|
||||
|
||||
+1164
File diff suppressed because it is too large
Load Diff
+33101
File diff suppressed because it is too large
Load Diff
+2
-2
@@ -1,7 +1,7 @@
|
||||
// Code generated by command: go generate gen.go. DO NOT EDIT.
|
||||
|
||||
//go:build !appengine && !noasm && gc && !nogen
|
||||
// +build !appengine,!noasm,gc,!nogen
|
||||
//go:build !appengine && !noasm && gc && !nogen && !nopshufb
|
||||
// +build !appengine,!noasm,gc,!nogen,!nopshufb
|
||||
|
||||
package reedsolomon
|
||||
|
||||
|
||||
+697
@@ -0,0 +1,697 @@
|
||||
// Code generated by command: go generate gen.go. DO NOT EDIT.
|
||||
|
||||
//go:build !appengine && !noasm && gc && !nogen && nopshufb
|
||||
// +build !appengine,!noasm,gc,!nogen,nopshufb
|
||||
|
||||
package reedsolomon
|
||||
|
||||
import (
|
||||
"fmt"
|
||||
)
|
||||
|
||||
const (
|
||||
avx2CodeGen = true
|
||||
maxAvx2Inputs = 10
|
||||
maxAvx2Outputs = 10
|
||||
minAvx2Size = 64
|
||||
avxSizeMask = maxInt - (minAvx2Size - 1)
|
||||
)
|
||||
|
||||
func galMulSlicesAvx2(matrix []byte, in, out [][]byte, start, stop int) int { panic(`no pshufb`) }
|
||||
func galMulSlicesAvx2Xor(matrix []byte, in, out [][]byte, start, stop int) int { panic(`no pshufb`) }
|
||||
|
||||
func galMulSlicesGFNI(matrix []uint64, in, out [][]byte, start, stop int) int {
|
||||
n := (stop - start) & avxSizeMask
|
||||
|
||||
switch len(in) {
|
||||
case 1:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_1x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_1x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_1x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_1x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_1x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_1x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_1x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_1x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_1x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_1x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 2:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_2x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_2x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_2x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_2x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_2x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_2x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_2x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_2x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_2x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_2x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 3:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_3x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_3x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_3x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_3x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_3x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_3x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_3x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_3x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_3x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_3x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 4:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_4x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_4x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_4x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_4x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_4x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_4x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_4x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_4x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_4x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_4x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 5:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_5x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_5x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_5x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_5x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_5x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_5x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_5x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_5x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_5x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_5x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 6:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_6x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_6x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_6x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_6x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_6x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_6x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_6x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_6x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_6x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_6x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 7:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_7x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_7x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_7x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_7x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_7x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_7x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_7x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_7x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_7x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_7x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 8:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_8x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_8x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_8x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_8x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_8x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_8x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_8x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_8x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_8x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_8x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 9:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_9x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_9x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_9x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_9x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_9x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_9x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_9x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_9x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_9x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_9x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 10:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_10x1_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_10x2_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_10x3_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_10x4_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_10x5_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_10x6_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_10x7_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_10x8_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_10x9_64(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_10x10_64(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
}
|
||||
panic(fmt.Sprintf("unhandled size: %dx%d", len(in), len(out)))
|
||||
}
|
||||
|
||||
func galMulSlicesGFNIXor(matrix []uint64, in, out [][]byte, start, stop int) int {
|
||||
n := (stop - start) & avxSizeMask
|
||||
|
||||
switch len(in) {
|
||||
case 1:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_1x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_1x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_1x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_1x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_1x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_1x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_1x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_1x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_1x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_1x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 2:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_2x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_2x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_2x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_2x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_2x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_2x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_2x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_2x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_2x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_2x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 3:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_3x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_3x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_3x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_3x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_3x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_3x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_3x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_3x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_3x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_3x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 4:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_4x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_4x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_4x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_4x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_4x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_4x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_4x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_4x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_4x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_4x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 5:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_5x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_5x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_5x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_5x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_5x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_5x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_5x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_5x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_5x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_5x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 6:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_6x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_6x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_6x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_6x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_6x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_6x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_6x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_6x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_6x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_6x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 7:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_7x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_7x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_7x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_7x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_7x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_7x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_7x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_7x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_7x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_7x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 8:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_8x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_8x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_8x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_8x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_8x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_8x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_8x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_8x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_8x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_8x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 9:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_9x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_9x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_9x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_9x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_9x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_9x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_9x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_9x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_9x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_9x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
case 10:
|
||||
switch len(out) {
|
||||
case 1:
|
||||
mulGFNI_10x1_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 2:
|
||||
mulGFNI_10x2_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 3:
|
||||
mulGFNI_10x3_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 4:
|
||||
mulGFNI_10x4_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 5:
|
||||
mulGFNI_10x5_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 6:
|
||||
mulGFNI_10x6_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 7:
|
||||
mulGFNI_10x7_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 8:
|
||||
mulGFNI_10x8_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 9:
|
||||
mulGFNI_10x9_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
case 10:
|
||||
mulGFNI_10x10_64Xor(matrix, in, out, start, n)
|
||||
return n
|
||||
}
|
||||
}
|
||||
panic(fmt.Sprintf("unhandled size: %dx%d", len(in), len(out)))
|
||||
}
|
||||
+3
-9
@@ -1,12 +1,11 @@
|
||||
//go:build (!amd64 || noasm || appengine || gccgo) && (!arm64 || noasm || appengine || gccgo) && (!ppc64le || noasm || appengine || gccgo)
|
||||
// +build !amd64 noasm appengine gccgo
|
||||
// +build !arm64 noasm appengine gccgo
|
||||
// +build !ppc64le noasm appengine gccgo
|
||||
//go:build (!amd64 || noasm || appengine || gccgo) && (!arm64 || noasm || appengine || gccgo || nopshufb) && (!ppc64le || noasm || appengine || gccgo || nopshufb)
|
||||
|
||||
// Copyright 2015, Klaus Post, see LICENSE for details.
|
||||
|
||||
package reedsolomon
|
||||
|
||||
const pshufb = false
|
||||
|
||||
func galMulSlice(c byte, in, out []byte, o *options) {
|
||||
out = out[:len(in)]
|
||||
if c == 1 {
|
||||
@@ -31,11 +30,6 @@ func galMulSliceXor(c byte, in, out []byte, o *options) {
|
||||
}
|
||||
}
|
||||
|
||||
// simple slice xor
|
||||
func sliceXor(in, out []byte, o *options) {
|
||||
sliceXorGo(in, out, o)
|
||||
}
|
||||
|
||||
func init() {
|
||||
defaultOptions.useAVX512 = false
|
||||
}
|
||||
|
||||
+146
@@ -0,0 +1,146 @@
|
||||
// Copyright 2015, Klaus Post, see LICENSE for details
|
||||
|
||||
//go:build nopshufb && !noasm
|
||||
|
||||
package reedsolomon
|
||||
|
||||
// bigSwitchover is the size where 64 bytes are processed per loop.
|
||||
const bigSwitchover = 128
|
||||
|
||||
const pshufb = false
|
||||
|
||||
// simple slice xor
|
||||
func sliceXor(in, out []byte, o *options) {
|
||||
if o.useSSE2 {
|
||||
if len(in) >= bigSwitchover {
|
||||
if o.useAVX2 {
|
||||
avx2XorSlice_64(in, out)
|
||||
done := (len(in) >> 6) << 6
|
||||
in = in[done:]
|
||||
out = out[done:]
|
||||
} else {
|
||||
sSE2XorSlice_64(in, out)
|
||||
done := (len(in) >> 6) << 6
|
||||
in = in[done:]
|
||||
out = out[done:]
|
||||
}
|
||||
}
|
||||
if len(in) >= 16 {
|
||||
sSE2XorSlice(in, out)
|
||||
done := (len(in) >> 4) << 4
|
||||
in = in[done:]
|
||||
out = out[done:]
|
||||
}
|
||||
} else {
|
||||
sliceXorGo(in, out, o)
|
||||
return
|
||||
}
|
||||
out = out[:len(in)]
|
||||
for i := range in {
|
||||
out[i] ^= in[i]
|
||||
}
|
||||
}
|
||||
|
||||
func galMulSlice(c byte, in, out []byte, o *options) {
|
||||
out = out[:len(in)]
|
||||
if c == 1 {
|
||||
copy(out, in)
|
||||
return
|
||||
}
|
||||
mt := mulTable[c][:256]
|
||||
for len(in) >= 4 {
|
||||
ii := (*[4]byte)(in)
|
||||
oo := (*[4]byte)(out)
|
||||
oo[0] = mt[ii[0]]
|
||||
oo[1] = mt[ii[1]]
|
||||
oo[2] = mt[ii[2]]
|
||||
oo[3] = mt[ii[3]]
|
||||
in = in[4:]
|
||||
out = out[4:]
|
||||
}
|
||||
for n, input := range in {
|
||||
out[n] = mt[input]
|
||||
}
|
||||
}
|
||||
|
||||
func galMulSliceXor(c byte, in, out []byte, o *options) {
|
||||
out = out[:len(in)]
|
||||
if c == 1 {
|
||||
sliceXor(in, out, o)
|
||||
return
|
||||
}
|
||||
mt := mulTable[c][:256]
|
||||
for len(in) >= 4 {
|
||||
ii := (*[4]byte)(in)
|
||||
oo := (*[4]byte)(out)
|
||||
oo[0] ^= mt[ii[0]]
|
||||
oo[1] ^= mt[ii[1]]
|
||||
oo[2] ^= mt[ii[2]]
|
||||
oo[3] ^= mt[ii[3]]
|
||||
in = in[4:]
|
||||
out = out[4:]
|
||||
}
|
||||
for n, input := range in {
|
||||
out[n] ^= mt[input]
|
||||
}
|
||||
}
|
||||
|
||||
func init() {
|
||||
defaultOptions.useAVX512 = false
|
||||
}
|
||||
|
||||
// 4-way butterfly
|
||||
func ifftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
|
||||
ifftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
|
||||
}
|
||||
|
||||
// 4-way butterfly
|
||||
func ifftDIT48(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe8, o *options) {
|
||||
ifftDIT4Ref8(work, dist, log_m01, log_m23, log_m02, o)
|
||||
}
|
||||
|
||||
// 4-way butterfly
|
||||
func fftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
|
||||
fftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
|
||||
}
|
||||
|
||||
// 4-way butterfly
|
||||
func fftDIT48(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe8, o *options) {
|
||||
fftDIT4Ref8(work, dist, log_m01, log_m23, log_m02, o)
|
||||
}
|
||||
|
||||
// 2-way butterfly forward
|
||||
func fftDIT2(x, y []byte, log_m ffe, o *options) {
|
||||
// Reference version:
|
||||
refMulAdd(x, y, log_m)
|
||||
sliceXor(x, y, o)
|
||||
}
|
||||
|
||||
// 2-way butterfly forward
|
||||
func fftDIT28(x, y []byte, log_m ffe8, o *options) {
|
||||
// Reference version:
|
||||
refMulAdd8(x, y, log_m)
|
||||
sliceXor(x, y, o)
|
||||
}
|
||||
|
||||
// 2-way butterfly inverse
|
||||
func ifftDIT2(x, y []byte, log_m ffe, o *options) {
|
||||
// Reference version:
|
||||
sliceXor(x, y, o)
|
||||
refMulAdd(x, y, log_m)
|
||||
}
|
||||
|
||||
// 2-way butterfly inverse
|
||||
func ifftDIT28(x, y []byte, log_m ffe8, o *options) {
|
||||
// Reference version:
|
||||
sliceXor(x, y, o)
|
||||
refMulAdd8(x, y, log_m)
|
||||
}
|
||||
|
||||
func mulgf16(x, y []byte, log_m ffe, o *options) {
|
||||
refMul(x, y, log_m)
|
||||
}
|
||||
|
||||
func mulgf8(x, y []byte, log_m ffe8, o *options) {
|
||||
refMul8(x, y, log_m)
|
||||
}
|
||||
+1
-2
@@ -1,5 +1,4 @@
|
||||
//go:build !amd64 || noasm || appengine || gccgo
|
||||
// +build !amd64 noasm appengine gccgo
|
||||
//go:build !amd64 || noasm || appengine || gccgo || pshufb
|
||||
|
||||
// Copyright 2020, Klaus Post, see LICENSE for details.
|
||||
|
||||
|
||||
+3
-7
@@ -1,11 +1,12 @@
|
||||
//go:build !noasm && !appengine && !gccgo
|
||||
// +build !noasm,!appengine,!gccgo
|
||||
//go:build !noasm && !appengine && !gccgo && !nopshufb
|
||||
|
||||
// Copyright 2015, Klaus Post, see LICENSE for details.
|
||||
// Copyright 2018, Minio, Inc.
|
||||
|
||||
package reedsolomon
|
||||
|
||||
const pshufb = true
|
||||
|
||||
//go:noescape
|
||||
func galMulPpc(low, high, in, out []byte)
|
||||
|
||||
@@ -66,11 +67,6 @@ func galMulSliceXor(c byte, in, out []byte, o *options) {
|
||||
}
|
||||
}
|
||||
|
||||
// slice galois add
|
||||
func sliceXor(in, out []byte, o *options) {
|
||||
sliceXorGo(in, out, o)
|
||||
}
|
||||
|
||||
// 4-way butterfly
|
||||
func ifftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
|
||||
ifftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
|
||||
|
||||
+1
@@ -1,6 +1,7 @@
|
||||
//+build !noasm
|
||||
//+build !appengine
|
||||
//+build !gccgo
|
||||
//+build !pshufb
|
||||
|
||||
// Copyright 2015, Klaus Post, see LICENSE for details.
|
||||
// Copyright 2018, Minio, Inc.
|
||||
|
||||
+3
-3
@@ -122,7 +122,7 @@ func (r *leopardFF16) Encode(shards [][]byte) error {
|
||||
func (r *leopardFF16) encode(shards [][]byte) error {
|
||||
shardSize := shardSize(shards)
|
||||
if shardSize%64 != 0 {
|
||||
return ErrShardSize
|
||||
return ErrInvalidShardSize
|
||||
}
|
||||
|
||||
m := ceilPow2(r.parityShards)
|
||||
@@ -303,7 +303,7 @@ func (r *leopardFF16) Split(data []byte) ([][]byte, error) {
|
||||
// Copy partial shards
|
||||
copyFrom := data[perShard*fullShards : dataLen]
|
||||
for i := range padding {
|
||||
if len(copyFrom) <= 0 {
|
||||
if len(copyFrom) == 0 {
|
||||
break
|
||||
}
|
||||
copyFrom = copyFrom[copy(padding[i], copyFrom):]
|
||||
@@ -409,7 +409,7 @@ func (r *leopardFF16) reconstruct(shards [][]byte, recoverAll bool) error {
|
||||
|
||||
shardSize := shardSize(shards)
|
||||
if shardSize%64 != 0 {
|
||||
return ErrShardSize
|
||||
return ErrInvalidShardSize
|
||||
}
|
||||
|
||||
m := ceilPow2(r.parityShards)
|
||||
|
||||
+3
-3
@@ -134,7 +134,7 @@ func (r *leopardFF8) Encode(shards [][]byte) error {
|
||||
func (r *leopardFF8) encode(shards [][]byte) error {
|
||||
shardSize := shardSize(shards)
|
||||
if shardSize%64 != 0 {
|
||||
return ErrShardSize
|
||||
return ErrInvalidShardSize
|
||||
}
|
||||
|
||||
m := ceilPow2(r.parityShards)
|
||||
@@ -344,7 +344,7 @@ func (r *leopardFF8) Split(data []byte) ([][]byte, error) {
|
||||
// Copy partial shards
|
||||
copyFrom := data[perShard*fullShards : dataLen]
|
||||
for i := range padding {
|
||||
if len(copyFrom) <= 0 {
|
||||
if len(copyFrom) == 0 {
|
||||
break
|
||||
}
|
||||
copyFrom = copyFrom[copy(padding[i], copyFrom):]
|
||||
@@ -442,7 +442,7 @@ func (r *leopardFF8) reconstruct(shards [][]byte, recoverAll bool) error {
|
||||
|
||||
shardSize := shardSize(shards)
|
||||
if shardSize%64 != 0 {
|
||||
return ErrShardSize
|
||||
return ErrInvalidShardSize
|
||||
}
|
||||
|
||||
// Use only if we are missing less than 1/4 parity,
|
||||
|
||||
+4
-5
@@ -67,11 +67,11 @@ var errColSizeMismatch = errors.New("column size is not the same for all rows")
|
||||
|
||||
func (m matrix) Check() error {
|
||||
rows := len(m)
|
||||
if rows <= 0 {
|
||||
if rows == 0 {
|
||||
return errInvalidRowSize
|
||||
}
|
||||
cols := len(m[0])
|
||||
if cols <= 0 {
|
||||
if cols == 0 {
|
||||
return errInvalidColSize
|
||||
}
|
||||
|
||||
@@ -175,8 +175,7 @@ func (m matrix) SwapRows(r1, r2 int) error {
|
||||
return nil
|
||||
}
|
||||
|
||||
// IsSquare will return true if the matrix is square
|
||||
// and nil if the matrix is square
|
||||
// IsSquare will return true if the matrix is square, otherwise false.
|
||||
func (m matrix) IsSquare() bool {
|
||||
return len(m) == len(m[0])
|
||||
}
|
||||
@@ -232,7 +231,7 @@ func (m matrix) gaussianElimination() error {
|
||||
}
|
||||
// Scale to 1.
|
||||
if m[r][r] != 1 {
|
||||
scale := galDivide(1, m[r][r])
|
||||
scale := galOneOver(m[r][r])
|
||||
for c := 0; c < columns; c++ {
|
||||
m[r][c] = galMultiply(m[r][c], scale)
|
||||
}
|
||||
|
||||
+77
-35
@@ -13,6 +13,7 @@ package reedsolomon
|
||||
import (
|
||||
"bytes"
|
||||
"errors"
|
||||
"fmt"
|
||||
"io"
|
||||
"runtime"
|
||||
"sync"
|
||||
@@ -171,7 +172,8 @@ type reedSolomon struct {
|
||||
tree *inversionTree
|
||||
parity [][]byte
|
||||
o options
|
||||
mPool sync.Pool
|
||||
mPoolSz int
|
||||
mPool sync.Pool // Pool for temp matrices, etc
|
||||
}
|
||||
|
||||
var _ = Extensions(&reedSolomon{})
|
||||
@@ -281,7 +283,7 @@ func buildMatrixJerasure(dataShards, totalShards int) (matrix, error) {
|
||||
// Multiply by the inverted matrix (same as vm.Multiply(vm[0:dataShards].Invert()))
|
||||
if vm[i][i] != 1 {
|
||||
// Make vm[i][i] = 1 by dividing the column by vm[i][i]
|
||||
tmp := galDivide(1, vm[i][i])
|
||||
tmp := galOneOver(vm[i][i])
|
||||
for j := 0; j < totalShards; j++ {
|
||||
vm[j][i] = galMultiply(vm[j][i], tmp)
|
||||
}
|
||||
@@ -301,7 +303,7 @@ func buildMatrixJerasure(dataShards, totalShards int) (matrix, error) {
|
||||
for j := 0; j < dataShards; j++ {
|
||||
tmp := vm[dataShards][j]
|
||||
if tmp != 1 {
|
||||
tmp = galDivide(1, tmp)
|
||||
tmp = galOneOver(tmp)
|
||||
for i := dataShards; i < totalShards; i++ {
|
||||
vm[i][j] = galMultiply(vm[i][j], tmp)
|
||||
}
|
||||
@@ -312,7 +314,7 @@ func buildMatrixJerasure(dataShards, totalShards int) (matrix, error) {
|
||||
for i := dataShards + 1; i < totalShards; i++ {
|
||||
tmp := vm[i][0]
|
||||
if tmp != 1 {
|
||||
tmp = galDivide(1, tmp)
|
||||
tmp = galOneOver(tmp)
|
||||
for j := 0; j < dataShards; j++ {
|
||||
vm[i][j] = galMultiply(vm[i][j], tmp)
|
||||
}
|
||||
@@ -475,11 +477,17 @@ func New(dataShards, parityShards int, opts ...Option) (Encoder, error) {
|
||||
|
||||
// Calculate what we want per round
|
||||
r.o.perRound = cpuid.CPU.Cache.L2
|
||||
if r.o.perRound < 128<<10 {
|
||||
r.o.perRound = 128 << 10
|
||||
}
|
||||
|
||||
divide := parityShards + 1
|
||||
if avx2CodeGen && r.o.useAVX2 && (dataShards > maxAvx2Inputs || parityShards > maxAvx2Outputs) {
|
||||
// Base on L1 cache if we have many inputs.
|
||||
r.o.perRound = cpuid.CPU.Cache.L1D
|
||||
if r.o.perRound < 32<<10 {
|
||||
r.o.perRound = 32 << 10
|
||||
}
|
||||
divide = 0
|
||||
if dataShards > maxAvx2Inputs {
|
||||
divide += maxAvx2Inputs
|
||||
@@ -493,11 +501,6 @@ func New(dataShards, parityShards int, opts ...Option) (Encoder, error) {
|
||||
}
|
||||
}
|
||||
|
||||
if r.o.perRound <= 0 {
|
||||
// Set to 128K if undetectable.
|
||||
r.o.perRound = 128 << 10
|
||||
}
|
||||
|
||||
if cpuid.CPU.ThreadsPerCore > 1 && r.o.maxGoroutines > cpuid.CPU.PhysicalCores {
|
||||
// If multiple threads per core, make sure they don't contend for cache.
|
||||
r.o.perRound /= cpuid.CPU.ThreadsPerCore
|
||||
@@ -508,6 +511,11 @@ func New(dataShards, parityShards int, opts ...Option) (Encoder, error) {
|
||||
// Align to 64 bytes.
|
||||
r.o.perRound = ((r.o.perRound + 63) / 64) * 64
|
||||
|
||||
// Final sanity check...
|
||||
if r.o.perRound < 1<<10 {
|
||||
r.o.perRound = 1 << 10
|
||||
}
|
||||
|
||||
if r.o.minSplitSize <= 0 {
|
||||
// Set minsplit as high as we can, but still have parity in L1.
|
||||
cacheSize := cpuid.CPU.Cache.L1D
|
||||
@@ -571,12 +579,28 @@ func New(dataShards, parityShards int, opts ...Option) (Encoder, error) {
|
||||
if avx2CodeGen && r.o.useAVX2 {
|
||||
sz := r.dataShards * r.parityShards * 2 * 32
|
||||
r.mPool.New = func() interface{} {
|
||||
return make([]byte, sz)
|
||||
return AllocAligned(1, sz)[0]
|
||||
}
|
||||
r.mPoolSz = sz
|
||||
}
|
||||
return &r, err
|
||||
}
|
||||
|
||||
func (r *reedSolomon) getTmpSlice() []byte {
|
||||
return r.mPool.Get().([]byte)
|
||||
}
|
||||
|
||||
func (r *reedSolomon) putTmpSlice(b []byte) {
|
||||
if b != nil && cap(b) >= r.mPoolSz {
|
||||
r.mPool.Put(b[:r.mPoolSz])
|
||||
return
|
||||
}
|
||||
if false {
|
||||
// Sanity check
|
||||
panic(fmt.Sprintf("got short tmp returned, want %d, got %d", r.mPoolSz, cap(b)))
|
||||
}
|
||||
}
|
||||
|
||||
// ErrTooFewShards is returned if too few shards where given to
|
||||
// Encode/Verify/Reconstruct/Update. It will also be returned from Reconstruct
|
||||
// if there were too few shards to reconstruct the missing data.
|
||||
@@ -628,6 +652,19 @@ func (r *reedSolomon) EncodeIdx(dataShard []byte, idx int, parity [][]byte) erro
|
||||
return ErrShardSize
|
||||
}
|
||||
|
||||
if avx2CodeGen && len(dataShard) >= r.o.perRound && len(parity) >= avx2CodeGenMinShards && ((pshufb && r.o.useAVX2) || r.o.useGFNI) {
|
||||
m := make([][]byte, r.parityShards)
|
||||
for iRow := range m {
|
||||
m[iRow] = r.parity[iRow][idx : idx+1]
|
||||
}
|
||||
if r.o.useGFNI {
|
||||
r.codeSomeShardsGFNI(m, [][]byte{dataShard}, parity, len(dataShard), false)
|
||||
} else {
|
||||
r.codeSomeShardsAVXP(m, [][]byte{dataShard}, parity, len(dataShard), false)
|
||||
}
|
||||
return nil
|
||||
}
|
||||
|
||||
// Process using no goroutines for now.
|
||||
start, end := 0, r.o.perRound
|
||||
if end > len(dataShard) {
|
||||
@@ -766,7 +803,7 @@ func (r *reedSolomon) Verify(shards [][]byte) (bool, error) {
|
||||
}
|
||||
|
||||
func (r *reedSolomon) canAVX2C(byteCount int, inputs, outputs int) bool {
|
||||
return avx2CodeGen && r.o.useAVX2 &&
|
||||
return avx2CodeGen && pshufb && r.o.useAVX2 &&
|
||||
byteCount >= avx2CodeGenMinSize && inputs+outputs >= avx2CodeGenMinShards &&
|
||||
inputs <= maxAvx2Inputs && outputs <= maxAvx2Outputs
|
||||
}
|
||||
@@ -806,16 +843,16 @@ func (r *reedSolomon) codeSomeShards(matrixRows, inputs, outputs [][]byte, byteC
|
||||
start += galMulSlicesGFNI(m, inputs, outputs, 0, byteCount)
|
||||
end = len(inputs[0])
|
||||
} else if r.canAVX2C(byteCount, len(inputs), len(outputs)) {
|
||||
m := genAvx2Matrix(matrixRows, len(inputs), 0, len(outputs), r.mPool.Get().([]byte))
|
||||
m := genAvx2Matrix(matrixRows, len(inputs), 0, len(outputs), r.getTmpSlice())
|
||||
start += galMulSlicesAvx2(m, inputs, outputs, 0, byteCount)
|
||||
r.mPool.Put(m)
|
||||
r.putTmpSlice(m)
|
||||
end = len(inputs[0])
|
||||
} else if len(inputs)+len(outputs) > avx2CodeGenMinShards && r.canAVX2C(byteCount, maxAvx2Inputs, maxAvx2Outputs) {
|
||||
var gfni [maxAvx2Inputs * maxAvx2Outputs]uint64
|
||||
end = len(inputs[0])
|
||||
inIdx := 0
|
||||
m := r.mPool.Get().([]byte)
|
||||
defer r.mPool.Put(m)
|
||||
m := r.getTmpSlice()
|
||||
defer r.putTmpSlice(m)
|
||||
ins := inputs
|
||||
for len(ins) > 0 {
|
||||
inPer := ins
|
||||
@@ -888,19 +925,19 @@ func (r *reedSolomon) codeSomeShardsP(matrixRows, inputs, outputs [][]byte, byte
|
||||
var tmp [maxAvx2Inputs * maxAvx2Outputs]uint64
|
||||
gfniMatrix = genGFNIMatrix(matrixRows, len(inputs), 0, len(outputs), tmp[:])
|
||||
} else if useAvx2 {
|
||||
avx2Matrix = genAvx2Matrix(matrixRows, len(inputs), 0, len(outputs), r.mPool.Get().([]byte))
|
||||
defer r.mPool.Put(avx2Matrix)
|
||||
avx2Matrix = genAvx2Matrix(matrixRows, len(inputs), 0, len(outputs), r.getTmpSlice())
|
||||
defer r.putTmpSlice(avx2Matrix)
|
||||
} else if r.o.useGFNI && byteCount < 10<<20 && len(inputs)+len(outputs) > avx2CodeGenMinShards &&
|
||||
r.canAVX2C(byteCount/4, maxAvx2Inputs, maxAvx2Outputs) {
|
||||
r.canGFNI(byteCount/4, maxAvx2Inputs, maxAvx2Outputs) {
|
||||
// It appears there is a switchover point at around 10MB where
|
||||
// Regular processing is faster...
|
||||
r.codeSomeShardsAVXP(matrixRows, inputs, outputs, byteCount)
|
||||
r.codeSomeShardsGFNI(matrixRows, inputs, outputs, byteCount, true)
|
||||
return
|
||||
} else if r.o.useAVX2 && byteCount < 10<<20 && len(inputs)+len(outputs) > avx2CodeGenMinShards &&
|
||||
r.canAVX2C(byteCount/4, maxAvx2Inputs, maxAvx2Outputs) {
|
||||
// It appears there is a switchover point at around 10MB where
|
||||
// Regular processing is faster...
|
||||
r.codeSomeShardsAVXP(matrixRows, inputs, outputs, byteCount)
|
||||
r.codeSomeShardsAVXP(matrixRows, inputs, outputs, byteCount, true)
|
||||
return
|
||||
}
|
||||
|
||||
@@ -964,7 +1001,8 @@ func (r *reedSolomon) codeSomeShardsP(matrixRows, inputs, outputs [][]byte, byte
|
||||
|
||||
// Perform the same as codeSomeShards, but split the workload into
|
||||
// several goroutines.
|
||||
func (r *reedSolomon) codeSomeShardsAVXP(matrixRows, inputs, outputs [][]byte, byteCount int) {
|
||||
// If clear is set, the first write will overwrite the output.
|
||||
func (r *reedSolomon) codeSomeShardsAVXP(matrixRows, inputs, outputs [][]byte, byteCount int, clear bool) {
|
||||
var wg sync.WaitGroup
|
||||
gor := r.o.maxGoroutines
|
||||
|
||||
@@ -977,10 +1015,8 @@ func (r *reedSolomon) codeSomeShardsAVXP(matrixRows, inputs, outputs [][]byte, b
|
||||
// Make a plan...
|
||||
plan := make([]state, 0, ((len(inputs)+maxAvx2Inputs-1)/maxAvx2Inputs)*((len(outputs)+maxAvx2Outputs-1)/maxAvx2Outputs))
|
||||
|
||||
tmp := r.mPool.Get().([]byte)
|
||||
defer func(b []byte) {
|
||||
r.mPool.Put(b)
|
||||
}(tmp)
|
||||
tmp := r.getTmpSlice()
|
||||
defer r.putTmpSlice(tmp)
|
||||
|
||||
// Flips between input first to output first.
|
||||
// We put the smallest data load in the inner loop.
|
||||
@@ -1006,7 +1042,7 @@ func (r *reedSolomon) codeSomeShardsAVXP(matrixRows, inputs, outputs [][]byte, b
|
||||
input: inPer,
|
||||
output: outPer,
|
||||
m: m,
|
||||
first: inIdx == 0,
|
||||
first: inIdx == 0 && clear,
|
||||
})
|
||||
outIdx += len(outPer)
|
||||
outs = outs[len(outPer):]
|
||||
@@ -1038,7 +1074,7 @@ func (r *reedSolomon) codeSomeShardsAVXP(matrixRows, inputs, outputs [][]byte, b
|
||||
input: inPer,
|
||||
output: outPer,
|
||||
m: m,
|
||||
first: inIdx == 0,
|
||||
first: inIdx == 0 && clear,
|
||||
})
|
||||
inIdx += len(inPer)
|
||||
ins = ins[len(inPer):]
|
||||
@@ -1054,6 +1090,7 @@ func (r *reedSolomon) codeSomeShardsAVXP(matrixRows, inputs, outputs [][]byte, b
|
||||
}
|
||||
|
||||
exec := func(start, stop int) {
|
||||
defer wg.Done()
|
||||
lstart, lstop := start, start+r.o.perRound
|
||||
if lstop > stop {
|
||||
lstop = stop
|
||||
@@ -1081,7 +1118,7 @@ func (r *reedSolomon) codeSomeShardsAVXP(matrixRows, inputs, outputs [][]byte, b
|
||||
for c := range inputs {
|
||||
in := inputs[c][lstart:lstop]
|
||||
for iRow := 0; iRow < len(outputs); iRow++ {
|
||||
if c == 0 {
|
||||
if c == 0 && clear {
|
||||
galMulSlice(matrixRows[iRow][c], in, outputs[iRow][lstart:lstop], &r.o)
|
||||
} else {
|
||||
galMulSliceXor(matrixRows[iRow][c], in, outputs[iRow][lstart:lstop], &r.o)
|
||||
@@ -1094,7 +1131,6 @@ func (r *reedSolomon) codeSomeShardsAVXP(matrixRows, inputs, outputs [][]byte, b
|
||||
lstop = stop
|
||||
}
|
||||
}
|
||||
wg.Done()
|
||||
}
|
||||
if gor == 1 {
|
||||
wg.Add(1)
|
||||
@@ -1119,7 +1155,8 @@ func (r *reedSolomon) codeSomeShardsAVXP(matrixRows, inputs, outputs [][]byte, b
|
||||
|
||||
// Perform the same as codeSomeShards, but split the workload into
|
||||
// several goroutines.
|
||||
func (r *reedSolomon) codeSomeShardsGFNI(matrixRows, inputs, outputs [][]byte, byteCount int) {
|
||||
// If clear is set, the first write will overwrite the output.
|
||||
func (r *reedSolomon) codeSomeShardsGFNI(matrixRows, inputs, outputs [][]byte, byteCount int, clear bool) {
|
||||
var wg sync.WaitGroup
|
||||
gor := r.o.maxGoroutines
|
||||
|
||||
@@ -1155,7 +1192,7 @@ func (r *reedSolomon) codeSomeShardsGFNI(matrixRows, inputs, outputs [][]byte, b
|
||||
input: inPer,
|
||||
output: outPer,
|
||||
m: m,
|
||||
first: inIdx == 0,
|
||||
first: inIdx == 0 && clear,
|
||||
})
|
||||
outIdx += len(outPer)
|
||||
outs = outs[len(outPer):]
|
||||
@@ -1186,7 +1223,7 @@ func (r *reedSolomon) codeSomeShardsGFNI(matrixRows, inputs, outputs [][]byte, b
|
||||
input: inPer,
|
||||
output: outPer,
|
||||
m: m,
|
||||
first: inIdx == 0,
|
||||
first: inIdx == 0 && clear,
|
||||
})
|
||||
inIdx += len(inPer)
|
||||
ins = ins[len(inPer):]
|
||||
@@ -1202,6 +1239,7 @@ func (r *reedSolomon) codeSomeShardsGFNI(matrixRows, inputs, outputs [][]byte, b
|
||||
}
|
||||
|
||||
exec := func(start, stop int) {
|
||||
defer wg.Done()
|
||||
lstart, lstop := start, start+r.o.perRound
|
||||
if lstop > stop {
|
||||
lstop = stop
|
||||
@@ -1229,7 +1267,7 @@ func (r *reedSolomon) codeSomeShardsGFNI(matrixRows, inputs, outputs [][]byte, b
|
||||
for c := range inputs {
|
||||
in := inputs[c][lstart:lstop]
|
||||
for iRow := 0; iRow < len(outputs); iRow++ {
|
||||
if c == 0 {
|
||||
if c == 0 && clear {
|
||||
galMulSlice(matrixRows[iRow][c], in, outputs[iRow][lstart:lstop], &r.o)
|
||||
} else {
|
||||
galMulSliceXor(matrixRows[iRow][c], in, outputs[iRow][lstart:lstop], &r.o)
|
||||
@@ -1242,8 +1280,8 @@ func (r *reedSolomon) codeSomeShardsGFNI(matrixRows, inputs, outputs [][]byte, b
|
||||
lstop = stop
|
||||
}
|
||||
}
|
||||
wg.Done()
|
||||
}
|
||||
|
||||
if gor == 1 {
|
||||
wg.Add(1)
|
||||
exec(0, byteCount)
|
||||
@@ -1292,6 +1330,10 @@ var ErrShardNoData = errors.New("no shard data")
|
||||
// shards.
|
||||
var ErrShardSize = errors.New("shard sizes do not match")
|
||||
|
||||
// ErrInvalidShardSize is returned if shard length doesn't meet the requirements,
|
||||
// typically a multiple of N.
|
||||
var ErrInvalidShardSize = errors.New("invalid shard size")
|
||||
|
||||
// checkShards will check if shards are the same size
|
||||
// or 0, if allowed. An error is returned if this fails.
|
||||
// An error is also returned if all shards are size 0.
|
||||
@@ -1591,7 +1633,7 @@ func (r *reedSolomon) Split(data []byte) ([][]byte, error) {
|
||||
// Copy partial shards
|
||||
copyFrom := data[perShard*fullShards : dataLen]
|
||||
for i := range padding {
|
||||
if len(copyFrom) <= 0 {
|
||||
if len(copyFrom) == 0 {
|
||||
break
|
||||
}
|
||||
copyFrom = copyFrom[copy(padding[i], copyFrom):]
|
||||
|
||||
+19
@@ -0,0 +1,19 @@
|
||||
//go:build !noasm && !appengine && !gccgo
|
||||
|
||||
package reedsolomon
|
||||
|
||||
//go:noescape
|
||||
func xorSliceNEON(in, out []byte)
|
||||
|
||||
// simple slice xor
|
||||
func sliceXor(in, out []byte, o *options) {
|
||||
xorSliceNEON(in, out)
|
||||
done := (len(in) >> 5) << 5
|
||||
|
||||
remain := len(in) - done
|
||||
if remain > 0 {
|
||||
for i := done; i < len(in); i++ {
|
||||
out[i] ^= in[i]
|
||||
}
|
||||
}
|
||||
}
|
||||
+29
@@ -0,0 +1,29 @@
|
||||
//+build !noasm
|
||||
//+build !appengine
|
||||
//+build !gccgo
|
||||
|
||||
// func xorSliceNEON(in, out []byte)
|
||||
TEXT ·xorSliceNEON(SB), 7, $0
|
||||
MOVD in_base+0(FP), R1
|
||||
MOVD in_len+8(FP), R2 // length of message
|
||||
MOVD out_base+24(FP), R5
|
||||
SUBS $32, R2
|
||||
BMI completeXor
|
||||
|
||||
loopXor:
|
||||
// Main loop
|
||||
VLD1.P 32(R1), [V0.B16, V1.B16]
|
||||
VLD1 (R5), [V20.B16, V21.B16]
|
||||
|
||||
VEOR V20.B16, V0.B16, V4.B16
|
||||
VEOR V21.B16, V1.B16, V5.B16
|
||||
|
||||
// Store result
|
||||
VST1.P [V4.D2, V5.D2], 32(R5)
|
||||
|
||||
SUBS $32, R2
|
||||
BPL loopXor
|
||||
|
||||
completeXor:
|
||||
RET
|
||||
|
||||
+7
@@ -0,0 +1,7 @@
|
||||
//go:build noasm || gccgo || appengine || (!amd64 && !arm64)
|
||||
|
||||
package reedsolomon
|
||||
|
||||
func sliceXor(in, out []byte, o *options) {
|
||||
sliceXorGo(in, out, o)
|
||||
}
|
||||
+40
-34
@@ -3,6 +3,7 @@ package kcp
|
||||
import (
|
||||
"encoding/binary"
|
||||
"sync/atomic"
|
||||
"time"
|
||||
|
||||
"github.com/klauspost/reedsolomon"
|
||||
)
|
||||
@@ -41,14 +42,12 @@ type fecDecoder struct {
|
||||
decodeCache [][]byte
|
||||
flagCache []bool
|
||||
|
||||
// zeros
|
||||
zeros []byte
|
||||
|
||||
// RS decoder
|
||||
codec reedsolomon.Encoder
|
||||
|
||||
// auto tune fec parameter
|
||||
autoTune autoTune
|
||||
autoTune autoTune
|
||||
shouldTune bool
|
||||
}
|
||||
|
||||
func newFECDecoder(dataShards, parityShards int) *fecDecoder {
|
||||
@@ -68,7 +67,6 @@ func newFECDecoder(dataShards, parityShards int) *fecDecoder {
|
||||
dec.codec = codec
|
||||
dec.decodeCache = make([][]byte, dec.shardSize)
|
||||
dec.flagCache = make([]bool, dec.shardSize)
|
||||
dec.zeros = make([]byte, mtuLimit)
|
||||
return dec
|
||||
}
|
||||
|
||||
@@ -82,18 +80,17 @@ func (dec *fecDecoder) decode(in fecPacket) (recovered [][]byte) {
|
||||
}
|
||||
|
||||
// check if FEC parameters is out of sync
|
||||
var shouldTune bool
|
||||
if int(in.seqid())%dec.shardSize < dec.dataShards {
|
||||
if in.flag() != typeData { // expect typeData
|
||||
shouldTune = true
|
||||
dec.shouldTune = true
|
||||
}
|
||||
} else {
|
||||
if in.flag() != typeParity {
|
||||
shouldTune = true
|
||||
dec.shouldTune = true
|
||||
}
|
||||
}
|
||||
|
||||
if shouldTune {
|
||||
if dec.shouldTune {
|
||||
autoDS := dec.autoTune.FindPeriod(true)
|
||||
autoPS := dec.autoTune.FindPeriod(false)
|
||||
|
||||
@@ -112,11 +109,17 @@ func (dec *fecDecoder) decode(in fecPacket) (recovered [][]byte) {
|
||||
dec.codec = codec
|
||||
dec.decodeCache = make([][]byte, dec.shardSize)
|
||||
dec.flagCache = make([]bool, dec.shardSize)
|
||||
dec.shouldTune = false
|
||||
//log.Println("autotune to :", dec.dataShards, dec.parityShards)
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
// parameters in tuning
|
||||
if dec.shouldTune {
|
||||
return nil
|
||||
}
|
||||
|
||||
// insertion
|
||||
n := len(dec.rx) - 1
|
||||
insertIdx := 0
|
||||
@@ -199,7 +202,7 @@ func (dec *fecDecoder) decode(in fecPacket) (recovered [][]byte) {
|
||||
if shards[k] != nil {
|
||||
dlen := len(shards[k])
|
||||
shards[k] = shards[k][:maxlen]
|
||||
copy(shards[k][dlen:], dec.zeros)
|
||||
clear(shards[k][dlen:])
|
||||
} else if k < dec.dataShards {
|
||||
shards[k] = xmitBuf.Get().([]byte)[:0]
|
||||
}
|
||||
@@ -276,11 +279,9 @@ type (
|
||||
payloadOffset int // FEC payload offset
|
||||
|
||||
// caches
|
||||
shardCache [][]byte
|
||||
encodeCache [][]byte
|
||||
|
||||
// zeros
|
||||
zeros []byte
|
||||
shardCache [][]byte
|
||||
encodeCache [][]byte
|
||||
tsLatestPacket int64
|
||||
|
||||
// RS encoder
|
||||
codec reedsolomon.Encoder
|
||||
@@ -311,13 +312,12 @@ func newFECEncoder(dataShards, parityShards, offset int) *fecEncoder {
|
||||
for k := range enc.shardCache {
|
||||
enc.shardCache[k] = make([]byte, mtuLimit)
|
||||
}
|
||||
enc.zeros = make([]byte, mtuLimit)
|
||||
return enc
|
||||
}
|
||||
|
||||
// encodes the packet, outputs parity shards if we have collected quorum datashards
|
||||
// notice: the contents of 'ps' will be re-written in successive calling
|
||||
func (enc *fecEncoder) encode(b []byte) (ps [][]byte) {
|
||||
func (enc *fecEncoder) encode(b []byte, rto uint32) (ps [][]byte) {
|
||||
// The header format:
|
||||
// | FEC SEQID(4B) | FEC TYPE(2B) | SIZE (2B) | PAYLOAD(SIZE-2) |
|
||||
// |<-headerOffset |<-payloadOffset
|
||||
@@ -336,26 +336,30 @@ func (enc *fecEncoder) encode(b []byte) (ps [][]byte) {
|
||||
}
|
||||
|
||||
// Generation of Reed-Solomon Erasure Code
|
||||
now := time.Now().UnixMilli()
|
||||
if enc.shardCount == enc.dataShards {
|
||||
// fill '0' into the tail of each datashard
|
||||
for i := 0; i < enc.dataShards; i++ {
|
||||
shard := enc.shardCache[i]
|
||||
slen := len(shard)
|
||||
copy(shard[slen:enc.maxSize], enc.zeros)
|
||||
}
|
||||
// generate the rs-code only if the data is continuous.
|
||||
if now-enc.tsLatestPacket < int64(rto) {
|
||||
// fill '0' into the tail of each datashard
|
||||
for i := 0; i < enc.dataShards; i++ {
|
||||
shard := enc.shardCache[i]
|
||||
slen := len(shard)
|
||||
clear(shard[slen:enc.maxSize])
|
||||
}
|
||||
|
||||
// construct equal-sized slice with stripped header
|
||||
cache := enc.encodeCache
|
||||
for k := range cache {
|
||||
cache[k] = enc.shardCache[k][enc.payloadOffset:enc.maxSize]
|
||||
}
|
||||
// construct equal-sized slice with stripped header
|
||||
cache := enc.encodeCache
|
||||
for k := range cache {
|
||||
cache[k] = enc.shardCache[k][enc.payloadOffset:enc.maxSize]
|
||||
}
|
||||
|
||||
// encoding
|
||||
if err := enc.codec.Encode(cache); err == nil {
|
||||
ps = enc.shardCache[enc.dataShards:]
|
||||
for k := range ps {
|
||||
enc.markParity(ps[k][enc.headerOffset:])
|
||||
ps[k] = ps[k][:enc.maxSize]
|
||||
// encoding
|
||||
if err := enc.codec.Encode(cache); err == nil {
|
||||
ps = enc.shardCache[enc.dataShards:]
|
||||
for k := range ps {
|
||||
enc.markParity(ps[k][enc.headerOffset:])
|
||||
ps[k] = ps[k][:enc.maxSize]
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
@@ -364,6 +368,8 @@ func (enc *fecEncoder) encode(b []byte) (ps [][]byte) {
|
||||
enc.maxSize = 0
|
||||
}
|
||||
|
||||
enc.tsLatestPacket = now
|
||||
|
||||
return
|
||||
}
|
||||
|
||||
|
||||
+1
-1
@@ -531,7 +531,7 @@ func (s *UDPSession) output(buf []byte) {
|
||||
|
||||
// 1. FEC encoding
|
||||
if s.fecEncoder != nil {
|
||||
ecc = s.fecEncoder.encode(buf)
|
||||
ecc = s.fecEncoder.encode(buf, s.kcp.rx_rto)
|
||||
}
|
||||
|
||||
// 2&3. crc32 & encryption
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !purego
|
||||
// +build !purego
|
||||
|
||||
// Package alias implements memory aliasing tests.
|
||||
package alias
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build purego
|
||||
// +build purego
|
||||
|
||||
// Package alias implements memory aliasing tests.
|
||||
package alias
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build amd64 && !purego && gc
|
||||
// +build amd64,!purego,gc
|
||||
|
||||
package salsa
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build amd64 && !purego && gc
|
||||
// +build amd64,!purego,gc
|
||||
|
||||
// This code was translated into a form compatible with 6a from the public
|
||||
// domain sources in SUPERCOP: https://bench.cr.yp.to/supercop.html
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !amd64 || purego || !gc
|
||||
// +build !amd64 purego !gc
|
||||
|
||||
package salsa
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || netbsd || openbsd
|
||||
// +build aix darwin dragonfly freebsd netbsd openbsd
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-2
@@ -3,8 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build (arm || mips || mipsle || 386 || ppc) && linux
|
||||
// +build arm mips mipsle 386 ppc
|
||||
// +build linux
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-2
@@ -3,8 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build (arm64 || amd64 || loong64 || ppc64 || ppc64le || mips64 || mips64le || riscv64 || s390x) && linux
|
||||
// +build arm64 amd64 loong64 ppc64 ppc64le mips64 mips64le riscv64 s390x
|
||||
// +build linux
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build amd64 && solaris
|
||||
// +build amd64,solaris
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !zos
|
||||
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris
|
||||
// +build darwin dragonfly freebsd linux netbsd openbsd solaris
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || windows || zos
|
||||
// +build aix windows zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,6 +3,5 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build darwin && go1.12
|
||||
// +build darwin,go1.12
|
||||
|
||||
// This exists solely so we can linkname in symbols from syscall.
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-2
@@ -3,8 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build (arm || mips || mipsle || 386 || ppc) && (darwin || dragonfly || freebsd || linux || netbsd || openbsd)
|
||||
// +build arm mips mipsle 386 ppc
|
||||
// +build darwin dragonfly freebsd linux netbsd openbsd
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-2
@@ -3,8 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build (arm64 || amd64 || loong64 || ppc64 || ppc64le || mips64 || mips64le || riscv64 || s390x) && (aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || zos)
|
||||
// +build arm64 amd64 loong64 ppc64 ppc64le mips64 mips64le riscv64 s390x
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build amd64 && solaris
|
||||
// +build amd64,solaris
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !zos
|
||||
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !linux && !netbsd
|
||||
// +build !aix,!linux,!netbsd
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || linux || netbsd
|
||||
// +build aix linux netbsd
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || netbsd || openbsd
|
||||
// +build aix darwin dragonfly freebsd netbsd openbsd
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || netbsd
|
||||
// +build aix darwin dragonfly freebsd netbsd
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-2
@@ -3,8 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build (arm || mips || mipsle || 386 || ppc) && linux
|
||||
// +build arm mips mipsle 386 ppc
|
||||
// +build linux
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-2
@@ -3,8 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build (arm64 || amd64 || loong64 || ppc64 || ppc64le || mips64 || mips64le || riscv64 || s390x) && linux
|
||||
// +build arm64 amd64 loong64 ppc64 ppc64le mips64 mips64le riscv64 s390x
|
||||
// +build linux
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build amd64 && solaris
|
||||
// +build amd64,solaris
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !zos
|
||||
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build s390x && zos
|
||||
// +build s390x,zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !race
|
||||
// +build !race
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build race
|
||||
// +build race
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build linux
|
||||
// +build linux
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || windows || zos
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris windows zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !linux
|
||||
// +build !linux
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !windows && !zos
|
||||
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!windows,!zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || openbsd || solaris
|
||||
// +build aix darwin dragonfly freebsd openbsd solaris
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build linux && !s390x && !386
|
||||
// +build linux,!s390x,!386
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build loong64
|
||||
// +build loong64
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build riscv64
|
||||
// +build riscv64
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || windows || zos
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris windows zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !windows && !zos
|
||||
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!windows,!zos
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
|
||||
// Added for go1.11 compatibility
|
||||
//go:build aix
|
||||
// +build aix
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -2,7 +2,6 @@
|
||||
// cgo -godefs defs_linux.go
|
||||
|
||||
//go:build loong64
|
||||
// +build loong64
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -2,7 +2,6 @@
|
||||
// cgo -godefs defs_linux.go
|
||||
|
||||
//go:build riscv64
|
||||
// +build riscv64
|
||||
|
||||
package socket
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || netbsd || openbsd
|
||||
// +build aix darwin dragonfly freebsd netbsd openbsd
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build darwin || linux || solaris
|
||||
// +build darwin linux solaris
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !windows && !zos
|
||||
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!windows,!zos
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !linux
|
||||
// +build !linux
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !zos
|
||||
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!zos
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || windows || zos
|
||||
// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris windows zos
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !darwin && !dragonfly && !freebsd && !linux && !netbsd && !openbsd && !solaris && !windows && !zos
|
||||
// +build !aix,!darwin,!dragonfly,!freebsd,!linux,!netbsd,!openbsd,!solaris,!windows,!zos
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -4,7 +4,6 @@
|
||||
|
||||
// Added for go1.11 compatibility
|
||||
//go:build aix
|
||||
// +build aix
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build aix || darwin || dragonfly || freebsd || netbsd || openbsd || solaris || windows
|
||||
// +build aix darwin dragonfly freebsd netbsd openbsd solaris windows
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !aix && !darwin && !dragonfly && !freebsd && !netbsd && !openbsd && !solaris && !windows
|
||||
// +build !aix,!darwin,!dragonfly,!freebsd,!netbsd,!openbsd,!solaris,!windows
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build darwin || freebsd || linux
|
||||
// +build darwin freebsd linux
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !darwin && !freebsd && !linux
|
||||
// +build !darwin,!freebsd,!linux
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build linux
|
||||
// +build linux
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
-1
@@ -3,7 +3,6 @@
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
//go:build !linux
|
||||
// +build !linux
|
||||
|
||||
package ipv4
|
||||
|
||||
|
||||
Some files were not shown because too many files have changed in this diff Show More
Reference in New Issue
Block a user